Erf4 - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Erf4 - Golgin subfamily A member 7/ERF4 family

PFAM:	PF10256	Sequences: IIRIQRDYSVGDLAPQFSTLYPEELDGRISEEEFRETINTINEILIEAFSPYSKRNFLDGVLGCLTGYLSDLCGETHYKKRLKKLEKWIEEWNEEVYNPRGLKIISPRRTGYLSLD	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	116 (114)
Sequences:	534 (392)
Seq/√Len:	36.7
META:	0.245

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
37_T	97_Y	5.708	1.00
91_E	95_E	3.604	1.00
98_N	103_K	3.205	1.00
37_T	104_I	3.019	1.00
47_E	81_R	2.832	1.00
41_I	89_I	2.740	1.00
89_I	104_I	2.549	1.00
7_D	11_G	2.419	1.00
69_L	73_C	2.112	0.99
54_K	83_K	2.006	0.99
31_E	35_R	2.004	0.99
98_N	102_L	1.824	0.97
19_T	34_F	1.757	0.97
75_E	83_K	1.752	0.96
46_I	58_L	1.621	0.95
3_R	110_T	1.607	0.94
44_I	88_W	1.571	0.94
21_Y	24_E	1.492	0.92
87_K	91_E	1.486	0.92
66_T	70_S	1.481	0.91
109_R	113_L	1.449	0.90
44_I	81_R	1.420	0.90
3_R	113_L	1.403	0.89
3_R	12_D	1.358	0.87
36_E	88_W	1.327	0.86
77_H	80_K	1.316	0.86
30_S	33_E	1.313	0.85
60_G	71_D	1.313	0.85
51_P	59_D	1.302	0.85
85_L	104_I	1.259	0.83
106_S	112_Y	1.239	0.82
34_F	38_I	1.234	0.82
37_T	88_W	1.220	0.81
80_K	84_K	1.210	0.80
17_F	82_L	1.209	0.80
110_T	113_L	1.203	0.80
41_I	103_K	1.155	0.77
21_Y	25_L	1.150	0.77
3_R	112_Y	1.136	0.76
89_I	105_I	1.131	0.76
2_I	44_I	1.120	0.75
63_G	68_Y	1.106	0.74
63_G	71_D	1.102	0.74
61_V	73_C	1.088	0.73
37_T	92_W	1.081	0.72
29_I	33_E	1.067	0.71
104_I	111_G	1.059	0.71
97_Y	104_I	1.048	0.70
92_W	97_Y	1.043	0.69
7_D	68_Y	1.035	0.69
68_Y	82_L	1.003	0.66
67_G	113_L	0.998	0.66
17_F	52_Y	0.979	0.65
40_T	88_W	0.973	0.64
43_E	46_I	0.968	0.64
76_T	79_K	0.966	0.63
34_F	69_L	0.963	0.63
47_E	54_K	0.963	0.63
2_I	9_S	0.956	0.63
35_R	79_K	0.955	0.63
86_E	115_L	0.954	0.62
3_R	108_R	0.948	0.62
24_E	27_G	0.945	0.62
32_E	39_N	0.945	0.62
82_L	85_L	0.944	0.62
47_E	66_T	0.943	0.62
48_A	59_D	0.942	0.61
38_I	89_I	0.942	0.61
40_T	55_R	0.922	0.60
50_S	94_E	0.911	0.59
39_N	99_P	0.909	0.59
103_K	115_L	0.909	0.59
51_P	74_G	0.908	0.59
44_I	84_K	0.904	0.58
58_L	62_L	0.901	0.58
81_R	85_L	0.899	0.58
33_E	62_L	0.893	0.57
18_S	56_N	0.892	0.57
29_I	97_Y	0.871	0.55
8_Y	68_Y	0.860	0.54
32_E	87_K	0.843	0.53
31_E	79_K	0.828	0.52
4_I	9_S	0.828	0.52
47_E	53_S	0.819	0.51
69_L	74_G	0.812	0.50
3_R	114_S	0.791	0.48
29_I	37_T	0.789	0.48
88_W	92_W	0.786	0.48
70_S	74_G	0.785	0.48
75_E	80_K	0.783	0.48
88_W	94_E	0.772	0.47
45_L	108_R	0.772	0.47
43_E	84_K	0.769	0.46
5_Q	114_S	0.767	0.46
37_T	78_Y	0.766	0.46
4_I	102_L	0.765	0.46
58_L	95_E	0.760	0.46
97_Y	100_R	0.757	0.45
3_R	15_P	0.756	0.45
34_F	84_K	0.745	0.44
108_R	113_L	0.737	0.44
61_V	86_E	0.737	0.44
29_I	98_N	0.734	0.43
61_V	111_G	0.733	0.43
38_I	53_S	0.730	0.43
16_Q	45_L	0.728	0.43
99_P	102_L	0.724	0.43
2_I	19_T	0.719	0.42
14_A	112_Y	0.714	0.42
28_R	98_N	0.713	0.42
6_R	11_G	0.712	0.42
66_T	90_E	0.708	0.41
2_I	15_P	0.707	0.41
85_L	89_I	0.706	0.41
95_E	102_L	0.703	0.41
39_N	53_S	0.700	0.41
75_E	78_Y	0.698	0.40
6_R	66_T	0.695	0.40
36_E	95_E	0.694	0.40
9_S	78_Y	0.691	0.40
5_Q	18_S	0.691	0.40
29_I	52_Y	0.685	0.39
46_I	99_P	0.683	0.39
4_I	11_G	0.680	0.39
2_I	6_R	0.663	0.37
4_I	30_S	0.657	0.37
96_V	99_P	0.655	0.37
3_R	45_L	0.647	0.36
12_D	45_L	0.636	0.35
46_I	85_L	0.630	0.35
42_N	93_N	0.627	0.35
22_P	104_I	0.626	0.34
38_I	78_Y	0.625	0.34
99_P	111_G	0.623	0.34
92_W	96_V	0.620	0.34
84_K	87_K	0.618	0.34
30_S	43_E	0.615	0.34
33_E	37_T	0.612	0.33
26_D	31_E	0.611	0.33
8_Y	59_D	0.605	0.33
28_R	102_L	0.599	0.32
103_K	116_D	0.595	0.32
62_L	109_R	0.593	0.32
54_K	96_V	0.591	0.32
32_E	99_P	0.589	0.32
18_S	35_R	0.586	0.31
58_L	94_E	0.583	0.31
43_E	55_R	0.582	0.31
32_E	60_G	0.580	0.31
18_S	29_I	0.576	0.31
80_K	85_L	0.574	0.30
84_K	90_E	0.563	0.30
86_E	106_S	0.560	0.29
18_S	21_Y	0.556	0.29
49_F	64_C	0.554	0.29
47_E	50_S	0.554	0.29
110_T	114_S	0.554	0.29
43_E	61_V	0.551	0.29
111_G	114_S	0.548	0.29
30_S	64_C	0.548	0.29
77_H	81_R	0.546	0.28
49_F	59_D	0.545	0.28
5_Q	8_Y	0.543	0.28
48_A	66_T	0.543	0.28
83_K	109_R	0.537	0.28
57_F	61_V	0.533	0.27
39_N	46_I	0.531	0.27
29_I	77_H	0.522	0.27
108_R	112_Y	0.515	0.26
39_N	95_E	0.514	0.26
48_A	91_E	0.500	0.25

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3nw0A	1	0.6293	15.4	0.913	Contact Map
3fqdA	1	0.6897	13.1	0.915	Contact Map
3a1jA	1	0.431	6.3	0.927	Contact Map
2z37A	1	0.7586	5.9	0.928	Contact Map
3cqlA	1	0.7586	4.8	0.93	Contact Map
2ougA	1	0.4052	4.8	0.931	Contact Map
3g65A	1	0.431	4.4	0.932	Contact Map
1ji5A	6	0.6897	4.4	0.932	Contact Map
2fefA	3	0.9397	3.9	0.933	Contact Map
3w3eA	1	0.75	3.5	0.935	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0054 seconds.