Pet191_N - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Pet191_N - Cytochrome c oxidase assembly protein PET191

PFAM:	PF10203	Sequences: SSSCKGLREALKECLLESDCVKKEGKTPKECLKEPDDELPEECQQLRKAFFECKRGMLDMRKRFRGN	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	67 (66)
Sequences:	516 (324)
Seq/√Len:	39.9
META:	0.395

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
27_T	30_E	3.527	1.00
56_G	67_N	3.041	1.00
26_K	30_E	2.814	1.00
6_G	10_A	2.382	1.00
8_R	50_F	2.300	1.00
15_L	28_P	1.899	0.98
11_L	32_L	1.831	0.98
19_D	23_K	1.810	0.98
3_S	67_N	1.758	0.97
34_E	37_D	1.716	0.97
63_R	66_G	1.676	0.96
17_E	22_K	1.621	0.96
61_R	65_R	1.556	0.95
54_K	65_R	1.517	0.94
55_R	59_D	1.510	0.94
60_M	63_R	1.432	0.92
21_V	28_P	1.418	0.91
29_K	59_D	1.394	0.91
8_R	64_F	1.383	0.90
20_C	31_C	1.379	0.90
41_E	45_Q	1.345	0.89
47_R	51_F	1.277	0.86
7_L	46_L	1.209	0.83
9_E	34_E	1.208	0.83
62_K	67_N	1.192	0.82
29_K	33_K	1.168	0.81
57_M	64_F	1.153	0.80
17_E	42_E	1.117	0.78
61_R	66_G	1.096	0.77
45_Q	48_K	1.090	0.76
32_L	47_R	1.077	0.75
13_E	17_E	1.076	0.75
23_K	40_P	1.040	0.73
19_D	22_K	0.978	0.68
41_E	44_Q	0.944	0.65
7_L	49_A	0.939	0.65
19_D	46_L	0.938	0.65
22_K	25_G	0.925	0.64
48_K	52_E	0.917	0.63
12_K	16_L	0.884	0.60
13_E	49_A	0.879	0.60
24_E	38_E	0.866	0.58
40_P	52_E	0.860	0.58
52_E	55_R	0.859	0.58
32_L	52_E	0.851	0.57
28_P	54_K	0.850	0.57
56_G	59_D	0.811	0.53
11_L	61_R	0.793	0.52
16_L	19_D	0.789	0.51
9_E	13_E	0.777	0.50
12_K	64_F	0.775	0.50
10_A	54_K	0.765	0.49
8_R	67_N	0.747	0.48
59_D	64_F	0.746	0.47
3_S	60_M	0.746	0.47
12_K	35_P	0.742	0.47
10_A	46_L	0.737	0.47
5_K	50_F	0.732	0.46
33_K	36_D	0.708	0.44
9_E	38_E	0.704	0.44
8_R	12_K	0.694	0.43
42_E	47_R	0.685	0.42
44_Q	48_K	0.683	0.42
18_S	40_P	0.683	0.42
13_E	29_K	0.683	0.42
4_C	14_C	0.682	0.42
56_G	62_K	0.673	0.41
2_S	67_N	0.673	0.41
14_C	20_C	0.669	0.41
26_K	36_D	0.668	0.40
33_K	37_D	0.666	0.40
11_L	14_C	0.660	0.40
10_A	57_M	0.653	0.39
15_L	33_K	0.649	0.39
22_K	42_E	0.648	0.39
15_L	38_E	0.632	0.37
28_P	39_L	0.628	0.37
19_D	40_P	0.628	0.37
12_K	27_T	0.628	0.37
7_L	45_Q	0.615	0.36
15_L	21_V	0.609	0.35
33_K	51_F	0.600	0.35
19_D	30_E	0.599	0.35
16_L	21_V	0.598	0.34
5_K	60_M	0.591	0.34
59_D	63_R	0.583	0.33
34_E	44_Q	0.581	0.33
5_K	9_E	0.574	0.32
11_L	51_F	0.564	0.32
16_L	45_Q	0.546	0.30
61_R	64_F	0.537	0.30
3_S	56_G	0.536	0.30
21_V	40_P	0.535	0.29
28_P	46_L	0.531	0.29
5_K	12_K	0.528	0.29
34_E	41_E	0.512	0.28
17_E	32_L	0.502	0.27
55_R	58_L	0.502	0.27
37_D	41_E	0.500	0.27

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2lqlA	1	0.8209	25.8	0.867	Contact Map
1ei0A	1	0.5672	19.7	0.874	Contact Map
2lqtA	1	0.7164	12	0.886	Contact Map
4ux8C	1	0.8955	7	0.897	Contact Map
1hp8A	1	0.6567	4.4	0.906	Contact Map
5aj3m	1	0.7313	3.5	0.911	Contact Map
2kjxA	1	0.8806	2	0.922	Contact Map
2k3jA	1	0.5672	1.9	0.922	Contact Map
1v54H	2	0.7761	1.2	0.93	Contact Map
4xizM	1	0.8507	1.2	0.931	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0044 seconds.