Mit_KHE1 - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Mit_KHE1 - Mitochondrial K+-H+ exchange-related

PFAM:	PF10173	Sequences: RLFLLPISTRRYLLYCERLDEALPEPSAAAAPAKPGLVDRLTRKAAETWAGWEKAEKGWKKKVVGYGNRLLDRIPYEEWGLKSIPPLSASAEQRLLWELRGQTKVELVYPSSLLSEEQVLRLLRRLLTRRQPRHRKWLIISLLGLPLTAPFALVPGIPNIPFFYFAFRAWSHWRALRGARHLEFLL	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	186 (178)
Sequences:	533 (434)
Seq/√Len:	32.5
META:	0.467

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
63_V	160_I	3.247	1.00
37_L	41_L	3.171	1.00
151_F	154_V	3.126	1.00
143_L	147_L	2.900	1.00
107_L	119_V	2.748	1.00
94_R	99_L	2.715	1.00
149_A	162_F	2.631	1.00
37_L	40_R	2.591	1.00
61_K	65_G	2.486	1.00
82_K	171_S	2.420	0.99
84_I	107_L	2.293	0.99
44_K	48_T	2.234	0.99
93_Q	96_L	2.232	0.99
78_E	82_K	2.216	0.99
45_A	49_W	2.144	0.99
133_R	137_W	2.110	0.98
138_L	145_L	1.995	0.98
94_R	97_W	1.974	0.98
79_W	82_K	1.892	0.97
44_K	47_E	1.825	0.96
145_L	169_A	1.816	0.96
78_E	81_L	1.807	0.96
49_W	53_E	1.799	0.96
138_L	142_L	1.789	0.96
14_L	164_Y	1.747	0.95
76_Y	79_W	1.729	0.95
145_L	162_F	1.719	0.94
162_F	166_A	1.669	0.94
148_T	154_V	1.631	0.93
87_L	95_L	1.604	0.92
97_W	100_R	1.580	0.91
167_F	178_G	1.563	0.91
138_L	169_A	1.562	0.91
181_H	184_F	1.562	0.91
77_E	81_L	1.511	0.90
159_N	168_R	1.510	0.90
40_R	44_K	1.507	0.89
40_R	47_E	1.506	0.89
30_A	33_A	1.500	0.89
175_A	178_G	1.500	0.89
93_Q	97_W	1.487	0.89
107_L	123_L	1.473	0.88
176_L	184_F	1.472	0.88
93_Q	99_L	1.472	0.88
96_L	99_L	1.457	0.88
87_L	94_R	1.423	0.86
9_T	84_I	1.410	0.86
178_G	181_H	1.402	0.86
94_R	100_R	1.381	0.85
175_A	179_A	1.378	0.85
155_P	159_N	1.374	0.84
115_S	118_Q	1.371	0.84
151_F	161_P	1.359	0.84
152_A	162_F	1.353	0.84
164_Y	168_R	1.343	0.83
162_F	171_S	1.310	0.81
158_P	172_H	1.304	0.81
79_W	83_S	1.296	0.81
55_A	58_G	1.292	0.81
71_L	75_P	1.285	0.80
95_L	183_E	1.267	0.79
4_L	17_E	1.257	0.79
96_L	100_R	1.232	0.77
166_A	170_W	1.228	0.77
158_P	163_F	1.226	0.77
40_R	52_W	1.226	0.77
154_V	161_P	1.224	0.77
137_W	140_I	1.221	0.77
149_A	152_A	1.206	0.76
53_E	56_E	1.160	0.73
48_T	53_E	1.159	0.73
161_P	169_A	1.146	0.72
87_L	98_E	1.145	0.72
78_E	146_P	1.135	0.71
95_L	98_E	1.129	0.71
176_L	179_A	1.125	0.70
123_L	126_L	1.120	0.70
141_S	165_F	1.112	0.70
175_A	182_L	1.093	0.68
139_I	143_L	1.085	0.68
68_N	80_G	1.075	0.67
162_F	165_F	1.061	0.66
150_P	153_L	1.060	0.66
49_W	52_W	1.054	0.65
151_F	163_F	1.053	0.65
95_L	99_L	1.030	0.64
134_H	172_H	1.028	0.63
66_Y	69_R	1.025	0.63
132_P	135_R	1.022	0.63
78_E	83_S	1.019	0.63
113_L	121_R	1.019	0.63
145_L	149_A	1.013	0.62
93_Q	100_R	1.007	0.62
97_W	114_L	0.990	0.60
137_W	141_S	0.987	0.60
158_P	162_F	0.980	0.60
155_P	168_R	0.978	0.59
146_P	163_F	0.973	0.59
170_W	174_R	0.971	0.59
74_I	78_E	0.963	0.58
49_W	55_A	0.956	0.58
114_L	127_L	0.943	0.57
136_K	154_V	0.942	0.57
150_P	162_F	0.941	0.56
1_R	12_Y	0.928	0.55
171_S	175_A	0.927	0.55
109_Y	113_L	0.926	0.55
34_K	42_T	0.919	0.55
67_G	71_L	0.919	0.55
150_P	161_P	0.918	0.55
16_C	184_F	0.916	0.54
29_A	32_P	0.909	0.54
68_N	71_L	0.904	0.53
65_G	69_R	0.891	0.52
55_A	60_K	0.883	0.52
71_L	79_W	0.878	0.51
67_G	70_L	0.878	0.51
129_R	133_R	0.871	0.51
60_K	67_G	0.866	0.50
69_R	72_D	0.858	0.50
162_F	173_W	0.856	0.49
64_V	83_S	0.855	0.49
88_S	98_E	0.848	0.49
149_A	161_P	0.847	0.49
171_S	179_A	0.836	0.48
14_L	84_I	0.836	0.48
84_I	138_L	0.831	0.47
59_W	67_G	0.826	0.47
121_R	125_R	0.824	0.47
3_F	14_L	0.819	0.46
88_S	93_Q	0.814	0.46
67_G	146_P	0.807	0.45
159_N	172_H	0.803	0.45
167_F	181_H	0.802	0.45
165_F	181_H	0.799	0.45
94_R	101_G	0.798	0.45
167_F	171_S	0.791	0.44
5_L	13_L	0.786	0.44
59_W	146_P	0.785	0.44
5_L	169_A	0.779	0.43
88_S	94_R	0.777	0.43
49_W	56_E	0.777	0.43
6_P	164_Y	0.773	0.43
105_V	110_P	0.767	0.42
57_K	153_L	0.764	0.42
45_A	53_E	0.760	0.42
48_T	55_A	0.758	0.41
67_G	161_P	0.756	0.41
33_A	37_L	0.752	0.41
16_C	164_Y	0.751	0.41
47_E	148_T	0.748	0.41
82_K	162_F	0.743	0.40
118_Q	125_R	0.742	0.40
142_L	146_P	0.741	0.40
144_G	164_Y	0.741	0.40
48_T	52_W	0.740	0.40
94_R	183_E	0.737	0.40
1_R	162_F	0.736	0.40
89_A	114_L	0.735	0.40
4_L	178_G	0.734	0.40
99_L	184_F	0.732	0.39
7_I	119_V	0.730	0.39
164_Y	181_H	0.729	0.39
150_P	154_V	0.726	0.39
50_A	173_W	0.720	0.38
120_L	123_L	0.714	0.38
74_I	77_E	0.705	0.37
5_L	20_D	0.698	0.37
39_D	42_T	0.698	0.37
83_S	176_L	0.698	0.37
88_S	99_L	0.697	0.37
71_L	80_G	0.696	0.37
105_V	123_L	0.695	0.37
102_Q	108_V	0.693	0.36
14_L	137_W	0.689	0.36
94_R	98_E	0.688	0.36
38_V	154_V	0.688	0.36
5_L	149_A	0.688	0.36
122_L	136_K	0.684	0.36
95_L	100_R	0.682	0.36
4_L	15_Y	0.680	0.35
71_L	76_Y	0.676	0.35
41_L	54_K	0.670	0.35
47_E	84_I	0.662	0.34
41_L	51_G	0.661	0.34
103_T	109_Y	0.645	0.33
60_K	138_L	0.644	0.33
121_R	156_G	0.643	0.33
141_S	164_Y	0.643	0.33
77_E	83_S	0.640	0.32
41_L	89_A	0.639	0.32
167_F	170_W	0.627	0.31
11_R	15_Y	0.625	0.31
161_P	165_F	0.625	0.31
7_I	177_R	0.619	0.31
97_W	112_S	0.619	0.31
78_E	126_L	0.617	0.31
1_R	73_R	0.615	0.31
7_I	34_K	0.614	0.31
13_L	167_F	0.614	0.31
81_L	84_I	0.612	0.30
87_L	99_L	0.611	0.30
168_R	172_H	0.611	0.30
2_L	119_V	0.610	0.30
13_L	171_S	0.609	0.30
37_L	121_R	0.605	0.30
36_G	113_L	0.605	0.30
137_W	144_G	0.605	0.30
144_G	147_L	0.604	0.30
87_L	114_L	0.602	0.30
75_P	78_E	0.601	0.30
5_L	136_K	0.598	0.29
113_L	118_Q	0.596	0.29
43_R	124_R	0.596	0.29
134_H	158_P	0.594	0.29
38_V	136_K	0.594	0.29
143_L	151_F	0.593	0.29
100_R	108_V	0.592	0.29
94_R	184_F	0.589	0.29
131_Q	183_E	0.588	0.29
142_L	149_A	0.586	0.29
45_A	52_W	0.586	0.29
3_F	15_Y	0.586	0.29
38_V	41_L	0.585	0.29
140_I	144_G	0.584	0.28
4_L	176_L	0.580	0.28
16_C	167_F	0.578	0.28
53_E	127_L	0.573	0.28
118_Q	121_R	0.572	0.28
64_V	68_N	0.571	0.28
95_L	112_S	0.571	0.28
158_P	166_A	0.569	0.27
40_R	48_T	0.566	0.27
89_A	93_Q	0.566	0.27
118_Q	122_L	0.566	0.27
158_P	168_R	0.559	0.27
163_F	172_H	0.558	0.27
109_Y	116_E	0.550	0.26
41_L	139_I	0.548	0.26
26_P	152_A	0.548	0.26
49_W	67_G	0.545	0.26
155_P	158_P	0.543	0.26
163_F	169_A	0.542	0.26
124_R	156_G	0.540	0.26
32_P	151_F	0.534	0.25
60_K	70_L	0.534	0.25
43_R	104_K	0.533	0.25
27_S	37_L	0.533	0.25
67_G	79_W	0.532	0.25
83_S	174_R	0.531	0.25
109_Y	131_Q	0.529	0.25
40_R	45_A	0.529	0.25
5_L	116_E	0.528	0.25
1_R	112_S	0.528	0.25
165_F	172_H	0.525	0.25
147_L	181_H	0.525	0.25
33_A	69_R	0.524	0.25
77_E	82_K	0.523	0.25
143_L	152_A	0.522	0.24
14_L	40_R	0.521	0.24
103_T	118_Q	0.519	0.24
73_R	82_K	0.518	0.24
34_K	38_V	0.515	0.24
82_K	173_W	0.514	0.24
153_L	166_A	0.510	0.24
66_Y	71_L	0.504	0.23
77_E	80_G	0.500	0.23

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3l8wA	4	0.629	4.1	0.96	Contact Map
1xc0A	1	0.1774	3.7	0.961	Contact Map
3swyA	3	0.2473	3.7	0.961	Contact Map
3fblA	1	0.1989	3.4	0.961	Contact Map
3w54A	2	0.5591	3.1	0.962	Contact Map
1faoA	1	0.1935	2.7	0.963	Contact Map
4n2xA	4	0.3441	2.5	0.964	Contact Map
2onkC	2	0.2742	2.4	0.964	Contact Map
1tjnA	4	0.2419	2.1	0.965	Contact Map
4lugA	3	0.3871	2	0.965	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0064 seconds.