G8 - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

G8 - G8 domain

PFAM:	PF10162	Sequences: TWPGGKVPGAGDRVTIPAGHTVVLDVSPPALRSLTIDGTLSFADDARDTELTVEWIMVHGGGELEIGTEANPITHKATITLTGDPDVDGEDGPDMGSKGIGVMSGGTLDLHGAPKTPTWTKLA	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	123 (118)
Sequences:	5893 (3997)
Seq/√Len:	367.9
META:	0.895

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
17_P	20_H	2.874	1.00
53_V	56_I	2.718	1.00
39_T	63_E	2.500	1.00
63_E	107_T	2.482	1.00
21_T	41_S	2.375	1.00
42_F	77_A	2.301	1.00
50_E	80_T	2.272	1.00
50_E	78_T	2.232	1.00
9_G	12_D	2.186	1.00
58_V	62_G	2.089	1.00
41_S	65_E	2.058	1.00
48_D	75_H	1.999	1.00
21_T	39_T	1.928	1.00
66_I	77_A	1.885	1.00
37_D	59_H	1.875	1.00
52_T	82_T	1.841	1.00
42_F	66_I	1.839	1.00
34_L	51_L	1.832	1.00
32_R	54_E	1.826	1.00
102_V	106_G	1.826	1.00
66_I	110_L	1.783	1.00
13_R	33_S	1.692	1.00
13_R	32_R	1.621	1.00
30_A	82_T	1.584	1.00
7_V	26_V	1.564	1.00
39_T	65_E	1.560	1.00
52_T	80_T	1.559	1.00
102_V	108_L	1.559	1.00
33_S	55_W	1.528	1.00
44_D	71_N	1.433	1.00
10_A	30_A	1.425	1.00
15_T	37_D	1.396	1.00
3_P	6_K	1.372	1.00
1_T	22_V	1.362	1.00
47_R	75_H	1.297	1.00
16_I	38_G	1.273	1.00
66_I	79_I	1.268	1.00
16_I	22_V	1.267	1.00
63_E	109_D	1.245	1.00
73_I	77_A	1.238	1.00
69_E	111_H	1.166	1.00
98_K	101_G	1.166	1.00
68_T	71_N	1.162	1.00
53_V	81_L	1.155	1.00
31_L	34_L	1.152	1.00
115_K	118_T	1.150	1.00
6_K	12_D	1.128	1.00
45_D	75_H	1.115	1.00
88_D	91_D	1.102	1.00
48_D	76_K	1.097	1.00
92_G	96_G	1.097	1.00
24_L	28_P	1.096	1.00
35_T	59_H	1.090	1.00
13_R	35_T	1.081	1.00
79_I	83_G	1.059	1.00
44_D	74_T	1.057	1.00
24_L	27_S	1.045	1.00
43_A	47_R	1.044	1.00
67_G	111_H	1.036	1.00
18_A	37_D	1.030	1.00
74_T	113_A	1.028	1.00
36_I	64_L	1.013	1.00
87_V	91_D	1.013	1.00
15_T	35_T	1.012	1.00
72_P	114_P	1.001	1.00
85_P	88_D	0.999	1.00
86_D	89_G	0.998	1.00
24_L	49_T	0.971	1.00
65_E	109_D	0.963	1.00
44_D	73_I	0.961	1.00
6_K	9_G	0.931	1.00
66_I	73_I	0.916	1.00
90_E	93_P	0.916	1.00
58_V	102_V	0.911	1.00
100_I	108_L	0.904	1.00
16_I	40_L	0.901	1.00
89_G	92_G	0.900	1.00
91_D	97_S	0.878	1.00
93_P	98_K	0.865	1.00
34_L	53_V	0.857	1.00
65_E	68_T	0.852	1.00
30_A	52_T	0.835	1.00
95_M	98_K	0.835	1.00
23_V	41_S	0.833	1.00
116_T	120_T	0.831	1.00
92_G	97_S	0.830	1.00
80_T	83_G	0.829	1.00
92_G	95_M	0.826	1.00
95_M	101_G	0.804	1.00
67_G	72_P	0.802	1.00
24_L	40_L	0.801	1.00
59_H	103_M	0.801	1.00
68_T	72_P	0.800	1.00
86_D	90_E	0.799	1.00
88_D	93_P	0.799	1.00
42_F	51_L	0.797	1.00
17_P	37_D	0.789	1.00
64_L	108_L	0.787	1.00
92_G	99_G	0.774	1.00
93_P	97_S	0.774	1.00
49_T	77_A	0.767	1.00
28_P	50_E	0.766	1.00
11_G	31_L	0.762	1.00
58_V	64_L	0.756	1.00
35_T	57_M	0.754	1.00
36_I	40_L	0.752	1.00
89_G	95_M	0.752	1.00
95_M	99_G	0.750	1.00
91_D	98_K	0.749	1.00
85_P	89_G	0.747	1.00
24_L	42_F	0.739	1.00
91_D	94_D	0.736	1.00
95_M	103_M	0.727	1.00
37_D	60_G	0.727	1.00
56_I	79_I	0.726	1.00
96_G	99_G	0.726	1.00
31_L	51_L	0.724	1.00
34_L	40_L	0.724	1.00
58_V	106_G	0.724	1.00
51_L	77_A	0.721	1.00
34_L	56_I	0.709	0.99
87_V	90_E	0.705	0.99
51_L	56_I	0.689	0.99
93_P	99_G	0.687	0.99
99_G	102_V	0.673	0.99
81_L	100_I	0.670	0.99
54_E	82_T	0.653	0.99
78_T	83_G	0.652	0.99
24_L	31_L	0.647	0.99
77_A	81_L	0.644	0.99
86_D	92_G	0.637	0.99
94_D	98_K	0.635	0.99
27_S	50_E	0.633	0.99
36_I	56_I	0.630	0.99
41_S	71_N	0.615	0.99
58_V	108_L	0.612	0.98
101_G	104_S	0.610	0.98
64_L	79_I	0.609	0.98
92_G	98_K	0.605	0.98
94_D	97_S	0.601	0.98
87_V	92_G	0.591	0.98
17_P	60_G	0.586	0.98
114_P	119_W	0.584	0.98
45_D	74_T	0.578	0.98
96_G	100_I	0.578	0.98
114_P	118_T	0.577	0.98
8_P	12_D	0.577	0.98
57_M	103_M	0.570	0.98
116_T	121_K	0.569	0.98
69_E	72_P	0.564	0.97
64_L	100_I	0.559	0.97
77_A	83_G	0.558	0.97
60_G	105_G	0.557	0.97
113_A	116_T	0.554	0.97
16_I	19_G	0.552	0.97
24_L	51_L	0.551	0.97
87_V	97_S	0.550	0.97
81_L	99_G	0.548	0.97
11_G	32_R	0.543	0.97
13_R	54_E	0.542	0.97
57_M	104_S	0.541	0.97
28_P	31_L	0.540	0.97
43_A	75_H	0.539	0.97
89_G	94_D	0.534	0.96
88_D	97_S	0.533	0.96
10_A	29_P	0.528	0.96
55_W	99_G	0.528	0.96
43_A	73_I	0.520	0.96
58_V	100_I	0.520	0.96
40_L	64_L	0.518	0.96
42_F	79_I	0.508	0.95
33_S	57_M	0.507	0.95
49_T	53_V	0.507	0.95
83_G	98_K	0.507	0.95
118_T	121_K	0.506	0.95
85_P	91_D	0.500	0.95
87_V	93_P	0.500	0.95

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3h09A	1	0.8293	55.5	0.854	Contact Map
3szeA	1	0.813	52.1	0.857	Contact Map
4om9A	1	0.813	48.9	0.859	Contact Map
3syjA	2	0.8293	48.2	0.86	Contact Map
1wxrA	1	0.8293	42.1	0.865	Contact Map
4peuA	1	0.8374	23	0.882	Contact Map
3uafA	2	0.5447	6.3	0.909	Contact Map
3qr8A	3	0.5935	5.7	0.91	Contact Map
1cpyA	1	0.6829	4.7	0.914	Contact Map
4w8qA	2	0.9268	4.4	0.915	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0062 seconds.