PhageMin_Tail - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

PhageMin_Tail - Phage-related minor tail protein

PFAM:	PF10145	Sequences: RDAAKELGATTGFSATELAEALYELASAGLSAEEALAALEAALKLAAAGGADDLAEAADALTSALNAFGLSADDAARVADVLAAAANNGATTVEDLAEALKRVGPVAAAAGVSLEETAAALAALANAGIKGSEAGTALRTILTRLTKEAAKALKKLGISVKDAAGKFKGLADILEDLAEALGGLTDAQRAAALATLFG	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	198 (192)
Sequences:	24868 (20671)
Seq/√Len:	1491.8
META:	0.864

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
40_E	44_K	3.095	1.00
168_K	176_D	2.903	1.00
85_A	118_A	2.665	1.00
84_A	88_N	2.526	1.00
81_V	115_E	2.240	1.00
3_A	6_E	2.216	1.00
77_R	81_V	2.183	1.00
77_R	115_E	2.117	1.00
81_V	118_A	2.101	1.00
6_E	10_T	2.066	1.00
74_D	77_R	2.062	1.00
23_Y	27_S	2.032	1.00
169_G	172_D	2.009	1.00
162_D	166_K	1.931	1.00
56_E	94_E	1.906	1.00
31_S	34_E	1.906	1.00
16_T	20_E	1.881	1.00
152_A	155_K	1.818	1.00
99_A	121_L	1.815	1.00
107_A	117_T	1.781	1.00
70_L	74_D	1.739	1.00
84_A	87_N	1.736	1.00
140_T	144_R	1.728	1.00
92_T	95_D	1.696	1.00
41_A	76_A	1.686	1.00
45_L	57_A	1.653	1.00
12_G	47_A	1.646	1.00
102_R	133_E	1.619	1.00
113_S	116_E	1.614	1.00
56_E	59_D	1.604	1.00
61_L	75_A	1.602	1.00
86_A	93_V	1.600	1.00
22_L	35_A	1.600	1.00
89_G	122_A	1.586	1.00
24_E	27_S	1.585	1.00
17_E	20_E	1.582	1.00
30_L	38_A	1.565	1.00
154_K	159_S	1.564	1.00
60_A	97_A	1.560	1.00
61_L	79_A	1.559	1.00
168_K	172_D	1.524	1.00
52_D	56_E	1.503	1.00
18_L	43_L	1.499	1.00
20_E	23_Y	1.469	1.00
85_A	122_A	1.463	1.00
185_T	188_Q	1.462	1.00
35_A	39_L	1.457	1.00
65_L	75_A	1.440	1.00
106_V	139_R	1.422	1.00
51_A	57_A	1.410	1.00
63_S	128_G	1.399	1.00
91_T	125_A	1.395	1.00
59_D	90_A	1.391	1.00
139_R	143_T	1.384	1.00
171_A	175_E	1.375	1.00
175_E	179_E	1.364	1.00
150_A	154_K	1.364	1.00
172_D	176_D	1.355	1.00
32_A	35_A	1.347	1.00
70_L	78_V	1.334	1.00
4_A	22_L	1.329	1.00
102_R	132_S	1.327	1.00
22_L	39_L	1.287	1.00
15_A	19_A	1.273	1.00
140_T	143_T	1.267	1.00
26_A	35_A	1.260	1.00
41_A	79_A	1.260	1.00
83_A	87_N	1.257	1.00
44_K	47_A	1.240	1.00
63_S	90_A	1.236	1.00
180_A	183_G	1.232	1.00
175_E	180_A	1.229	1.00
10_T	40_E	1.220	1.00
43_L	47_A	1.213	1.00
24_E	55_A	1.204	1.00
191_A	195_T	1.193	1.00
45_L	93_V	1.184	1.00
98_E	101_K	1.180	1.00
71_S	74_D	1.177	1.00
33_E	37_A	1.156	1.00
25_L	42_A	1.146	1.00
13_F	17_E	1.134	1.00
75_A	79_A	1.132	1.00
146_T	149_A	1.127	1.00
65_L	70_L	1.122	1.00
147_K	151_K	1.117	1.00
161_K	166_K	1.112	1.00
45_L	79_A	1.108	1.00
152_A	156_L	1.107	1.00
103_V	117_T	1.106	1.00
67_A	104_G	1.105	1.00
25_L	38_A	1.098	1.00
91_T	96_L	1.091	1.00
159_S	162_D	1.089	1.00
55_A	59_D	1.079	1.00
13_F	43_L	1.078	1.00
20_E	24_E	1.077	1.00
107_A	112_V	1.072	1.00
94_E	98_E	1.067	1.00
106_V	109_A	1.041	1.00
123_A	127_A	1.038	1.00
5_K	9_A	1.033	1.00
98_E	132_S	1.028	1.00
14_S	17_E	1.015	1.00
13_F	47_A	1.015	1.00
35_A	38_A	1.006	1.00
42_A	61_L	0.998	1.00
149_A	153_L	0.998	1.00
60_A	64_A	0.991	1.00
3_A	36_L	0.981	1.00
112_V	142_L	0.979	1.00
172_D	175_E	0.978	1.00
41_A	44_K	0.975	1.00
123_A	126_N	0.975	1.00
168_K	173_I	0.965	1.00
37_A	40_E	0.961	1.00
161_K	165_G	0.956	1.00
3_A	7_L	0.954	1.00
186_D	189_R	0.954	1.00
150_A	155_K	0.953	1.00
112_V	116_E	0.951	1.00
176_D	179_E	0.948	1.00
175_E	178_A	0.943	1.00
176_D	180_A	0.942	1.00
124_L	134_A	0.941	1.00
165_G	168_K	0.941	1.00
148_E	152_A	0.936	1.00
130_K	133_E	0.926	1.00
76_A	80_D	0.925	1.00
18_L	21_A	0.920	1.00
149_A	152_A	0.915	1.00
20_E	55_A	0.910	1.00
34_E	37_A	0.902	1.00
21_A	54_L	0.902	1.00
119_A	123_A	0.897	1.00
25_L	58_A	0.896	1.00
100_L	118_A	0.887	1.00
150_A	159_S	0.884	1.00
37_A	41_A	0.884	1.00
120_A	138_L	0.883	1.00
178_A	182_G	0.880	1.00
7_L	43_L	0.879	1.00
116_E	171_A	0.878	1.00
78_V	114_L	0.871	1.00
188_Q	191_A	0.870	1.00
181_L	193_L	0.865	1.00
28_A	90_A	0.859	1.00
28_A	62_T	0.854	1.00
149_A	156_L	0.851	1.00
153_L	156_L	0.850	1.00
54_L	61_L	0.849	1.00
52_D	55_A	0.844	1.00
32_A	36_L	0.843	1.00
11_T	43_L	0.843	1.00
91_T	131_G	0.842	1.00
63_S	130_K	0.838	1.00
81_V	114_L	0.838	1.00
102_R	139_R	0.831	1.00
146_T	150_A	0.830	1.00
118_A	123_A	0.821	1.00
182_G	187_A	0.818	1.00
110_A	142_L	0.815	1.00
136_T	139_R	0.804	1.00
7_L	18_L	0.800	1.00
6_E	9_A	0.799	1.00
101_K	133_E	0.797	1.00
54_L	57_A	0.792	1.00
171_A	180_A	0.786	1.00
147_K	150_A	0.782	1.00
3_A	22_L	0.780	1.00
151_K	155_K	0.776	1.00
184_L	192_A	0.776	1.00
117_T	121_L	0.775	1.00
181_L	184_L	0.773	1.00
133_E	137_A	0.769	1.00
59_D	63_S	0.767	1.00
5_K	10_T	0.764	1.00
69_G	108_A	0.763	1.00
75_A	82_L	0.755	1.00
161_K	187_A	0.753	1.00
160_V	163_A	0.751	1.00
161_K	164_A	0.750	1.00
121_L	135_G	0.749	1.00
44_K	76_A	0.748	1.00
147_K	152_A	0.748	1.00
70_L	73_D	0.741	1.00
3_A	40_E	0.739	1.00
64_A	82_L	0.734	1.00
129_I	137_A	0.731	1.00
72_A	75_A	0.724	1.00
98_E	102_R	0.723	1.00
162_D	165_G	0.714	1.00
64_A	78_V	0.707	1.00
95_D	125_A	0.705	1.00
21_A	43_L	0.705	1.00
148_E	151_K	0.704	1.00
65_L	71_S	0.700	1.00
66_N	71_S	0.698	1.00
81_V	84_A	0.696	1.00
136_T	140_T	0.693	1.00
54_L	58_A	0.692	1.00
95_D	130_K	0.690	1.00
117_T	120_A	0.690	1.00
100_L	104_G	0.690	1.00
153_L	160_V	0.685	1.00
62_T	90_A	0.675	1.00
114_L	118_A	0.674	1.00
165_G	169_G	0.666	1.00
5_K	8_G	0.663	1.00
81_V	85_A	0.662	1.00
51_A	56_E	0.661	1.00
41_A	45_L	0.661	1.00
163_A	166_K	0.660	1.00
132_S	136_T	0.658	1.00
13_F	46_A	0.656	1.00
57_A	61_L	0.651	1.00
13_F	18_L	0.650	1.00
177_L	181_L	0.648	1.00
52_D	57_A	0.645	1.00
121_L	134_A	0.644	1.00
86_A	96_L	0.644	1.00
158_I	176_D	0.642	1.00
38_A	75_A	0.629	1.00
19_A	23_Y	0.624	1.00
68_F	117_T	0.622	1.00
95_D	131_G	0.620	1.00
24_E	59_D	0.620	1.00
55_A	64_A	0.614	1.00
30_L	34_E	0.614	1.00
106_V	110_A	0.612	1.00
69_G	74_D	0.610	1.00
36_L	40_E	0.609	1.00
108_A	113_S	0.609	1.00
153_L	158_I	0.608	1.00
103_V	107_A	0.602	1.00
68_F	104_G	0.602	1.00
120_A	124_L	0.599	1.00
25_L	39_L	0.597	1.00
99_A	135_G	0.593	1.00
64_A	114_L	0.590	1.00
102_R	135_G	0.590	1.00
70_L	114_L	0.590	1.00
11_T	18_L	0.589	1.00
179_E	182_G	0.588	1.00
21_A	39_L	0.580	1.00
165_G	173_I	0.578	1.00
169_G	173_I	0.576	1.00
120_A	123_A	0.576	1.00
131_G	135_G	0.576	1.00
190_A	194_A	0.575	1.00
138_L	142_L	0.574	1.00
4_A	18_L	0.573	1.00
120_A	170_L	0.569	1.00
42_A	58_A	0.566	1.00
18_L	22_L	0.565	1.00
21_A	58_A	0.561	1.00
122_A	126_N	0.556	1.00
164_A	168_K	0.554	1.00
65_L	72_A	0.554	1.00
160_V	164_A	0.554	1.00
113_S	117_T	0.552	1.00
76_A	85_A	0.549	1.00
160_V	167_F	0.549	1.00
76_A	81_V	0.548	1.00
41_A	75_A	0.548	1.00
26_A	32_A	0.547	1.00
192_A	195_T	0.547	1.00
150_A	153_L	0.546	1.00
107_A	142_L	0.543	1.00
151_K	154_K	0.542	1.00
134_A	137_A	0.540	1.00
163_A	170_L	0.537	1.00
65_L	78_V	0.537	1.00
184_L	187_A	0.537	1.00
7_L	11_T	0.535	1.00
105_P	109_A	0.535	1.00
133_E	136_T	0.533	1.00
23_Y	86_A	0.528	1.00
137_A	141_I	0.526	1.00
91_T	95_D	0.524	1.00
46_A	54_L	0.519	1.00
56_E	60_A	0.518	1.00
33_E	38_A	0.518	1.00
129_I	133_E	0.511	1.00
181_L	189_R	0.510	1.00
131_G	134_A	0.507	1.00
171_A	176_D	0.500	1.00
135_G	141_I	0.500	1.00

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2ch7A	2	0.8737	42.8	0.881	Contact Map
1vw1A	5	0.9444	28.6	0.892	Contact Map
4f7gB	1	0.6313	17.8	0.902	Contact Map
3zx6A	2	0.8687	14.5	0.906	Contact Map
1qu7A	2	0.6111	13.8	0.907	Contact Map
3tntA	2	0.303	13.6	0.907	Contact Map
3gwkC	2	0.4495	13	0.908	Contact Map
3favA	1	0.4545	10	0.912	Contact Map
3g67A	2	0.9192	9.6	0.913	Contact Map
3zbhA	2	0.4848	9	0.914	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0073 seconds.