MethyTransf_Reg - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

MethyTransf_Reg - Predicted methyltransferase regulatory domain

PFAM:	PF10119	Sequences: DDSYLAHEYLEEDNEPVYFHEFAARAAAHGLQYLGEADLSDMLDALLLPEVAQALLALAPDPVLREQYLDFLRNRRFRRDLLCR	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	84 (83)
Sequences:	10245 (7816)
Seq/√Len:	857.9
META:	0.96

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
22_F	82_L	3.012	1.00
17_V	25_R	2.597	1.00
26_A	82_L	2.548	1.00
61_D	64_L	2.520	1.00
54_A	57_A	2.172	1.00
18_Y	21_E	1.991	1.00
4_Y	9_Y	1.946	1.00
19_F	23_A	1.810	1.00
35_G	42_M	1.805	1.00
23_A	63_V	1.799	1.00
27_A	32_Q	1.799	1.00
20_H	67_Q	1.769	1.00
4_Y	8_E	1.767	1.00
56_L	59_A	1.625	1.00
53_Q	57_A	1.565	1.00
21_E	24_A	1.564	1.00
25_R	28_A	1.546	1.00
18_Y	71_F	1.517	1.00
23_A	27_A	1.362	1.00
48_L	51_V	1.360	1.00
17_V	22_F	1.348	1.00
24_A	63_V	1.346	1.00
49_P	52_A	1.340	1.00
23_A	26_A	1.311	1.00
48_L	52_A	1.304	1.00
11_E	14_N	1.301	1.00
54_A	58_L	1.300	1.00
25_R	29_H	1.284	1.00
59_A	68_Y	1.235	1.00
34_L	83_C	1.233	1.00
20_H	24_A	1.214	1.00
67_Q	71_F	1.209	1.00
38_D	79_R	1.205	1.00
7_H	11_E	1.193	1.00
41_D	75_R	1.159	1.00
52_A	72_L	1.134	1.00
47_L	51_V	1.098	1.00
33_Y	36_E	1.084	1.00
60_P	64_L	1.068	1.00
69_L	73_R	1.058	1.00
49_P	53_Q	1.053	1.00
38_D	41_D	1.049	1.00
56_L	65_R	1.037	1.00
39_L	42_M	1.024	1.00
41_D	73_R	1.019	1.00
44_D	65_R	1.018	1.00
50_E	54_A	1.005	1.00
19_F	33_Y	1.000	1.00
8_E	11_E	0.992	1.00
53_Q	56_L	0.970	1.00
24_A	27_A	0.964	1.00
22_F	25_R	0.934	1.00
70_D	75_R	0.916	1.00
50_E	53_Q	0.906	1.00
66_E	69_L	0.902	1.00
18_Y	67_Q	0.899	1.00
19_F	66_E	0.894	1.00
43_L	46_L	0.887	1.00
19_F	67_Q	0.886	1.00
55_L	58_L	0.886	1.00
41_D	79_R	0.872	1.00
32_Q	83_C	0.861	1.00
34_L	81_L	0.850	1.00
41_D	45_A	0.843	1.00
55_L	59_A	0.838	1.00
6_A	9_Y	0.819	1.00
40_S	46_L	0.817	1.00
6_A	11_E	0.803	1.00
48_L	56_L	0.802	1.00
51_V	56_L	0.801	1.00
19_F	63_V	0.799	1.00
15_E	21_E	0.791	1.00
64_L	68_Y	0.789	1.00
15_E	25_R	0.788	1.00
24_A	28_A	0.782	1.00
52_A	56_L	0.779	1.00
80_D	83_C	0.771	1.00
27_A	63_V	0.766	1.00
23_A	82_L	0.763	1.00
62_P	66_E	0.760	1.00
48_L	54_A	0.757	1.00
68_Y	72_L	0.718	1.00
68_Y	71_F	0.711	1.00
26_A	80_D	0.704	1.00
39_L	43_L	0.692	1.00
36_E	80_D	0.690	1.00
5_L	10_L	0.689	1.00
73_R	76_R	0.676	1.00
20_H	63_V	0.671	1.00
44_D	69_L	0.669	1.00
9_Y	14_N	0.664	1.00
26_A	29_H	0.661	1.00
3_S	6_A	0.653	1.00
39_L	81_L	0.646	1.00
20_H	64_L	0.638	1.00
22_F	26_A	0.614	1.00
62_P	65_R	0.612	1.00
36_E	41_D	0.604	1.00
59_A	65_R	0.601	1.00
60_P	65_R	0.595	1.00
51_V	58_L	0.590	1.00
57_A	60_P	0.588	1.00
65_R	69_L	0.585	1.00
65_R	68_Y	0.581	1.00
66_E	78_R	0.572	1.00
36_E	75_R	0.549	1.00
13_D	16_P	0.549	1.00
32_Q	62_P	0.546	1.00
42_M	69_L	0.544	1.00
46_L	65_R	0.544	1.00
33_Y	80_D	0.539	1.00
59_A	64_L	0.539	1.00
8_E	77_F	0.539	1.00
38_D	42_M	0.524	1.00
30_G	64_L	0.524	1.00
15_E	18_Y	0.522	1.00
9_Y	13_D	0.521	1.00
76_R	79_R	0.519	1.00
46_L	73_R	0.517	1.00
37_A	81_L	0.506	1.00
40_S	44_D	0.506	1.00
17_V	21_E	0.500	1.00
41_D	69_L	0.500	1.00
43_L	56_L	0.500	1.00

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
1snnA	2	0.5238	7.2	0.89	Contact Map
2bpoA	1	0.9167	5.8	0.895	Contact Map
1tksA	2	0.5357	4.8	0.899	Contact Map
1g57A	2	0.6071	4.1	0.902	Contact Map
1ddgA	1	0.9167	3.8	0.904	Contact Map
3qfsA	1	0.9286	3.8	0.904	Contact Map
4p6dA	2	0.6071	3.7	0.905	Contact Map
3mioA	2	0.5595	3.6	0.905	Contact Map
4a2qA	1	0.9762	3.6	0.905	Contact Map
3cl6A	3	0.5952	3.3	0.907	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0052 seconds.