Halogen_Hydrol - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Halogen_Hydrol - 5-bromo-4-chloroindolyl phosphate hydrolysis protein

PFAM:	PF10112	Sequences: ILGSILAGLLAALVFLLAAFGLGLPLLLALLIAALGGLLLYLFDPKPKKKKGLKAEGLDREEIDRVAEALDEAEEKLAEIRDANDRIRDRELSARLDRIEAIARKIFRTVEEDPRDLRQARKFLNYYLPGARKLTEKYADLERQGVKGEEIKETLAEIEALLDDLETAFEKQLDKLLEDDALDLDVEIEVL	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	191 (185)
Sequences:	2853 (2418)
Seq/√Len:	177.8
META:	0.753

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
95_R	163_D	3.557	1.00
76_K	129_P	3.501	1.00
79_E	136_E	3.148	1.00
42_L	45_P	3.056	1.00
98_R	170_E	2.874	1.00
38_L	42_L	2.556	1.00
39_L	42_L	2.414	1.00
113_D	116_D	2.332	1.00
41_Y	44_D	2.267	1.00
73_A	107_F	2.237	1.00
36_G	40_L	2.169	1.00
37_G	41_Y	2.101	1.00
40_L	44_D	2.101	1.00
109_T	113_D	2.025	1.00
36_G	39_L	1.995	1.00
81_R	100_E	1.993	1.00
36_G	43_F	1.984	1.00
15_F	19_A	1.885	1.00
40_L	45_P	1.834	1.00
69_A	117_L	1.795	1.00
84_N	93_S	1.777	1.00
11_A	15_F	1.768	1.00
98_R	166_E	1.748	1.00
36_G	44_D	1.743	1.00
38_L	43_F	1.741	1.00
8_G	12_A	1.675	1.00
7_A	11_A	1.667	1.00
39_L	43_F	1.664	1.00
153_E	157_E	1.628	1.00
37_G	43_F	1.618	1.00
40_L	43_F	1.599	1.00
41_Y	45_P	1.591	1.00
39_L	44_D	1.568	1.00
102_I	170_E	1.546	1.00
92_L	162_L	1.536	1.00
185_D	189_E	1.522	1.00
7_A	10_L	1.512	1.00
116_D	179_D	1.509	1.00
22_L	25_P	1.505	1.00
142_E	155_L	1.502	1.00
77_L	103_A	1.476	1.00
109_T	112_E	1.466	1.00
79_E	132_R	1.409	1.00
26_L	29_A	1.406	1.00
14_V	18_A	1.402	1.00
135_T	158_I	1.392	1.00
34_A	42_L	1.390	1.00
35_L	40_L	1.389	1.00
47_P	50_K	1.378	1.00
81_R	104_R	1.361	1.00
47_P	51_K	1.358	1.00
95_R	166_E	1.355	1.00
110_V	117_L	1.347	1.00
84_N	96_L	1.337	1.00
49_K	53_L	1.335	1.00
102_I	166_E	1.321	1.00
91_E	159_E	1.306	1.00
161_L	164_D	1.290	1.00
38_L	44_D	1.290	1.00
37_G	42_L	1.283	1.00
46_K	50_K	1.271	1.00
68_E	72_E	1.271	1.00
11_A	19_A	1.259	1.00
156_A	160_A	1.259	1.00
34_A	39_L	1.246	1.00
38_L	45_P	1.246	1.00
35_L	39_L	1.238	1.00
36_G	41_Y	1.236	1.00
89_D	159_E	1.231	1.00
92_L	159_E	1.223	1.00
66_V	69_A	1.220	1.00
30_L	33_A	1.220	1.00
12_A	15_F	1.212	1.00
96_L	135_T	1.211	1.00
134_L	158_I	1.207	1.00
110_V	120_A	1.205	1.00
19_A	23_G	1.196	1.00
182_L	186_V	1.190	1.00
36_G	42_L	1.190	1.00
34_A	43_F	1.176	1.00
46_K	51_K	1.173	1.00
13_L	17_L	1.162	1.00
49_K	52_G	1.155	1.00
79_E	83_A	1.151	1.00
10_L	13_L	1.149	1.00
48_K	51_K	1.144	1.00
39_L	45_P	1.130	1.00
19_A	29_A	1.127	1.00
126_Y	130_G	1.119	1.00
83_A	139_A	1.109	1.00
85_D	93_S	1.101	1.00
133_K	137_K	1.099	1.00
48_K	53_L	1.099	1.00
18_A	21_G	1.087	1.00
11_A	14_V	1.072	1.00
47_P	52_G	1.061	1.00
146_V	150_E	1.055	1.00
142_E	145_G	1.053	1.00
131_A	169_F	1.050	1.00
94_A	98_R	1.046	1.00
100_E	104_R	1.040	1.00
48_K	52_G	1.034	0.99
15_F	20_F	1.025	0.99
131_A	165_L	1.022	0.99
108_R	111_E	1.017	0.99
71_D	75_E	1.015	0.99
84_N	97_D	1.011	0.99
150_E	155_L	1.001	0.99
22_L	28_L	0.993	0.99
15_F	18_A	0.980	0.99
142_E	146_V	0.971	0.99
50_K	53_L	0.961	0.99
23_G	29_A	0.961	0.99
14_V	19_A	0.957	0.99
10_L	15_F	0.943	0.99
109_T	116_D	0.941	0.99
81_R	97_D	0.934	0.99
74_E	78_A	0.927	0.99
37_G	44_D	0.926	0.99
113_D	179_D	0.926	0.99
25_P	29_A	0.920	0.99
37_G	45_P	0.913	0.99
14_V	17_L	0.904	0.99
46_K	49_K	0.903	0.99
151_I	154_T	0.882	0.98
83_A	136_E	0.881	0.98
107_F	124_L	0.877	0.98
37_G	40_L	0.875	0.98
133_K	183_D	0.874	0.98
58_L	61_E	0.871	0.98
112_E	140_D	0.867	0.98
52_G	55_A	0.865	0.98
20_F	23_G	0.860	0.98
22_L	29_A	0.856	0.98
87_I	93_S	0.851	0.98
69_A	73_A	0.841	0.98
66_V	117_L	0.837	0.98
116_D	180_D	0.826	0.98
38_L	41_Y	0.824	0.97
59_D	62_E	0.822	0.97
142_E	147_K	0.815	0.97
24_L	28_L	0.812	0.97
35_L	38_L	0.806	0.97
149_E	153_E	0.805	0.97
87_I	92_L	0.800	0.97
150_E	174_D	0.789	0.97
137_K	183_D	0.782	0.97
161_L	165_L	0.781	0.97
76_K	79_E	0.781	0.97
74_E	104_R	0.781	0.97
119_Q	176_L	0.780	0.97
73_A	128_L	0.777	0.96
18_A	22_L	0.775	0.96
96_L	100_E	0.763	0.96
130_G	187_E	0.743	0.95
70_L	74_E	0.743	0.95
113_D	180_D	0.741	0.95
79_E	82_D	0.735	0.95
24_L	29_A	0.735	0.95
19_A	22_L	0.733	0.95
158_I	184_L	0.733	0.95
8_G	14_V	0.728	0.95
136_E	140_D	0.728	0.95
109_T	180_D	0.727	0.95
74_E	111_E	0.726	0.95
14_V	21_G	0.726	0.95
105_K	174_D	0.726	0.95
50_K	54_K	0.725	0.95
99_I	166_E	0.722	0.95
144_Q	147_K	0.721	0.95
21_G	26_L	0.720	0.95
15_F	26_L	0.717	0.94
84_N	100_E	0.715	0.94
174_D	177_L	0.712	0.94
106_I	123_F	0.707	0.94
18_A	24_L	0.705	0.94
81_R	85_D	0.699	0.94
69_A	107_F	0.694	0.93
73_A	124_L	0.688	0.93
16_L	27_L	0.685	0.93
60_R	63_I	0.672	0.92
93_S	96_L	0.672	0.92
15_F	22_L	0.672	0.92
57_G	60_R	0.671	0.92
29_A	32_I	0.669	0.92
76_K	132_R	0.667	0.92
35_L	44_D	0.663	0.92
12_A	16_L	0.662	0.92
106_I	172_Q	0.661	0.92
184_L	188_I	0.659	0.92
86_R	139_A	0.659	0.92
19_A	27_L	0.657	0.91
103_A	169_F	0.656	0.91
51_K	55_A	0.654	0.91
167_T	171_K	0.653	0.91
77_L	100_E	0.649	0.91
36_G	45_P	0.646	0.91
84_N	92_L	0.644	0.91
127_Y	169_F	0.644	0.91
22_L	26_L	0.643	0.91
137_K	180_D	0.643	0.91
87_I	138_Y	0.640	0.90
18_A	25_P	0.639	0.90
75_E	78_A	0.637	0.90
109_T	177_L	0.635	0.90
177_L	180_D	0.635	0.90
26_L	30_L	0.634	0.90
16_L	20_F	0.631	0.90
147_K	155_L	0.629	0.90
101_A	105_K	0.621	0.89
105_K	173_L	0.618	0.89
156_A	159_E	0.614	0.88
13_L	16_L	0.614	0.88
83_A	132_R	0.613	0.88
23_G	26_L	0.612	0.88
130_G	134_L	0.612	0.88
80_I	135_T	0.609	0.88
21_G	24_L	0.608	0.88
17_L	20_F	0.606	0.88
108_R	112_E	0.593	0.87
155_L	158_I	0.591	0.87
43_F	46_K	0.589	0.86
16_L	19_A	0.588	0.86
106_I	176_L	0.587	0.86
99_I	165_L	0.584	0.86
12_A	19_A	0.580	0.85
123_F	172_Q	0.575	0.85
19_A	25_P	0.575	0.85
80_I	131_A	0.575	0.85
17_L	21_G	0.572	0.85
72_E	76_K	0.568	0.84
66_V	70_L	0.567	0.84
24_L	27_L	0.564	0.84
120_A	129_P	0.562	0.84
126_Y	168_A	0.561	0.84
147_K	150_E	0.560	0.83
72_E	125_N	0.558	0.83
162_L	166_E	0.557	0.83
78_A	81_R	0.555	0.83
21_G	25_P	0.553	0.83
17_L	27_L	0.550	0.82
33_A	42_L	0.550	0.82
21_G	27_L	0.549	0.82
53_L	56_E	0.548	0.82
163_D	167_T	0.545	0.82
15_F	21_G	0.544	0.82
105_K	144_Q	0.543	0.82
178_E	182_L	0.543	0.82
137_K	164_D	0.542	0.81
174_D	178_E	0.542	0.81
56_E	59_D	0.541	0.81
10_L	14_V	0.541	0.81
172_Q	176_L	0.541	0.81
20_F	26_L	0.536	0.81
35_L	43_F	0.535	0.81
80_I	100_E	0.534	0.81
80_I	132_R	0.534	0.81
9_L	12_A	0.533	0.80
67_A	70_L	0.533	0.80
173_L	177_L	0.530	0.80
83_A	135_T	0.529	0.80
82_D	86_R	0.528	0.80
35_L	45_P	0.527	0.80
73_A	186_V	0.522	0.79
22_L	27_L	0.520	0.79
122_K	127_Y	0.518	0.78
86_R	140_D	0.517	0.78
18_A	29_A	0.515	0.78
56_E	61_E	0.515	0.78
55_A	59_D	0.514	0.78
57_G	61_E	0.514	0.78
74_E	107_F	0.511	0.78
93_S	100_E	0.511	0.78
142_E	150_E	0.506	0.77
34_A	37_G	0.502	0.76
110_V	176_L	0.501	0.76
78_A	82_D	0.501	0.76
99_I	176_L	0.500	0.76

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
4aurA	1	0.5602	34.3	0.908	Contact Map
3l1lA	2	0.2932	33.6	0.908	Contact Map
2mi2A	1	0.5445	32.8	0.908	Contact Map
4ltoA	3	0.4188	30.7	0.91	Contact Map
4cbcA	3	0.2042	27.6	0.912	Contact Map
2mmuA	1	0.2251	24.8	0.914	Contact Map
2j69A	1	0.7435	22.4	0.916	Contact Map
4w6vA	1	0.267	17.5	0.92	Contact Map
2msvA	1	0.644	17	0.92	Contact Map
3giaA	1	0.3089	16.7	0.92	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0069 seconds.