Phage_TAC_7 - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Phage_TAC_7 - Phage tail assembly chaperone proteins, E, or 41 or 14

PFAM:	PF10109	Sequences: TITLKKPITRGGETITELTLREPTAGDLRGAGLADLGGGDVDGEMGAEIALLARLTGLPPEEIEELDPADLAALQEAVAGFL	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	82 (77)
Sequences:	4326 (3499)
Seq/√Len:	398.8
META:	0.72

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
22_E	67_D	3.094	1.00
21_R	27_D	2.744	1.00
24_T	65_E	2.645	1.00
9_T	14_T	2.600	1.00
29_R	64_E	2.418	1.00
26_G	64_E	2.203	1.00
59_P	62_E	2.134	1.00
25_A	71_L	2.134	1.00
3_T	17_E	2.003	1.00
30_G	54_R	1.990	1.00
6_K	67_D	1.874	1.00
2_I	74_L	1.708	1.00
20_L	56_T	1.670	1.00
2_I	77_A	1.607	1.00
10_R	62_E	1.578	1.00
6_K	22_E	1.568	1.00
24_T	27_D	1.558	1.00
50_A	60_P	1.432	1.00
26_G	65_E	1.428	1.00
23_P	55_L	1.424	1.00
58_L	62_E	1.392	1.00
18_L	58_L	1.330	1.00
67_D	70_D	1.330	1.00
5_K	73_A	1.287	1.00
52_L	74_L	1.264	1.00
58_L	63_I	1.242	1.00
49_I	64_E	1.241	1.00
20_L	74_L	1.208	1.00
52_L	78_V	1.172	1.00
28_L	68_P	1.165	1.00
3_T	16_T	1.158	1.00
2_I	73_A	1.157	1.00
18_L	56_T	1.127	1.00
22_E	69_A	1.099	1.00
31_A	51_L	1.078	1.00
49_I	63_I	1.073	1.00
18_L	74_L	1.027	1.00
60_P	64_E	1.006	1.00
71_L	75_Q	1.000	1.00
66_L	74_L	0.999	1.00
25_A	49_I	0.994	1.00
76_E	79_A	0.981	1.00
7_P	14_T	0.975	1.00
27_D	54_R	0.969	1.00
74_L	77_A	0.962	1.00
48_E	75_Q	0.953	1.00
29_R	49_I	0.951	1.00
15_I	62_E	0.939	1.00
9_T	12_G	0.903	1.00
21_R	57_G	0.869	1.00
52_L	63_I	0.858	1.00
53_A	60_P	0.816	1.00
7_P	16_T	0.812	1.00
35_D	38_G	0.806	1.00
11_G	62_E	0.801	1.00
32_G	47_A	0.797	1.00
26_G	30_G	0.791	1.00
10_R	15_I	0.788	1.00
39_G	42_D	0.787	1.00
4_L	70_D	0.779	1.00
53_A	63_I	0.776	1.00
49_I	71_L	0.773	1.00
5_K	70_D	0.773	1.00
31_A	54_R	0.772	1.00
5_K	69_A	0.761	1.00
34_A	37_G	0.747	1.00
2_I	20_L	0.747	1.00
24_T	67_D	0.745	1.00
10_R	13_E	0.743	1.00
66_L	70_D	0.738	1.00
26_G	29_R	0.723	1.00
8_I	62_E	0.722	1.00
35_D	39_G	0.712	1.00
6_K	69_A	0.709	1.00
4_L	18_L	0.703	1.00
48_E	71_L	0.697	1.00
25_A	68_P	0.692	1.00
27_D	55_L	0.692	1.00
29_R	32_G	0.683	0.99
77_A	80_G	0.669	0.99
72_A	76_E	0.660	0.99
8_I	65_E	0.657	0.99
34_A	39_G	0.655	0.99
48_E	52_L	0.650	0.99
56_T	63_I	0.646	0.99
13_E	16_T	0.645	0.99
70_D	73_A	0.639	0.99
73_A	77_A	0.634	0.99
19_T	57_G	0.626	0.99
34_A	38_G	0.622	0.99
13_E	58_L	0.615	0.99
33_L	38_G	0.613	0.99
2_I	5_K	0.606	0.99
21_R	55_L	0.605	0.99
15_I	58_L	0.603	0.99
50_A	54_R	0.586	0.98
8_I	11_G	0.572	0.98
49_I	60_P	0.570	0.98
51_L	55_L	0.565	0.98
31_A	50_A	0.549	0.98
35_D	42_D	0.548	0.98
9_T	15_I	0.544	0.97
5_K	67_D	0.543	0.97
36_L	40_D	0.541	0.97
20_L	52_L	0.539	0.97
52_L	55_L	0.538	0.97
79_A	82_L	0.533	0.97
73_A	76_E	0.527	0.97
8_I	58_L	0.523	0.97
36_L	39_G	0.522	0.97
24_T	57_G	0.521	0.97
41_V	47_A	0.516	0.97
47_A	50_A	0.509	0.96
40_D	47_A	0.507	0.96
69_A	73_A	0.501	0.96
20_L	77_A	0.500	0.96

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3j3iA	6	0.939	10	0.85	Contact Map
4bjsA	3	0.561	4.4	0.873	Contact Map
1iykA	2	0.8537	3.7	0.877	Contact Map
3iu1A	1	0.9024	3.6	0.878	Contact Map
1rxtA	1	0.9024	3.3	0.881	Contact Map
4c7iA	1	0.9024	3	0.883	Contact Map
4g0dW	1	0.1951	2.9	0.884	Contact Map
2vxeA	1	0.4512	2.8	0.885	Contact Map
1iicA	1	0.8537	2.7	0.886	Contact Map
4c68A	1	0.878	2.7	0.886	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0052 seconds.