DUF2285 - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

DUF2285 - Uncharacterized conserved protein (DUF2285)

PFAM:	PF10074	Sequences: VLPLDADFEARLAAARRLWRALAGRRPGPDPRALPLPPQRRRRLILALRALDARLAGASYREIAEALFGADRVAARDWKTSSLRDRVRRLVRRGRALMRGGYRRLLR	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	107 (102)
Sequences:	2430 (1652)
Seq/√Len:	163.6
META:	0.813

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
51_L	98_M	5.497	1.00
55_L	98_M	3.206	1.00
47_A	93_R	2.786	1.00
54_R	95_R	2.617	1.00
53_A	58_A	2.421	1.00
60_Y	91_V	2.216	1.00
60_Y	88_R	2.147	1.00
49_R	53_A	2.012	1.00
46_L	49_R	1.978	1.00
50_A	91_V	1.973	1.00
46_L	86_R	1.828	1.00
82_S	86_R	1.812	1.00
60_Y	84_R	1.729	1.00
45_I	49_R	1.675	1.00
53_A	63_I	1.659	1.00
51_L	94_G	1.604	1.00
13_A	16_R	1.572	1.00
53_A	66_A	1.552	1.00
5_D	11_R	1.457	1.00
73_V	83_L	1.436	1.00
69_G	73_V	1.412	1.00
47_A	94_G	1.401	1.00
12_L	16_R	1.377	1.00
49_R	58_A	1.358	1.00
54_R	91_V	1.351	1.00
16_R	20_R	1.351	1.00
97_L	101_G	1.345	1.00
58_A	66_A	1.316	1.00
95_R	99_R	1.311	1.00
61_R	78_W	1.308	1.00
81_S	84_R	1.296	1.00
59_S	62_E	1.285	1.00
72_R	77_D	1.274	1.00
8_F	15_A	1.271	1.00
85_D	88_R	1.265	1.00
58_A	62_E	1.228	1.00
82_S	85_D	1.197	1.00
68_F	87_V	1.195	1.00
79_K	88_R	1.178	1.00
41_R	44_L	1.175	1.00
78_W	106_L	1.170	1.00
50_A	63_I	1.170	1.00
43_R	89_R	1.157	1.00
81_S	85_D	1.152	1.00
65_E	73_V	1.147	1.00
54_R	94_G	1.111	1.00
18_L	21_A	1.102	1.00
87_V	91_V	1.100	1.00
20_R	24_G	1.099	1.00
50_A	54_R	1.085	1.00
47_A	90_L	1.075	0.99
50_A	94_G	1.075	0.99
24_G	28_G	1.072	0.99
65_E	70_A	1.048	0.99
54_R	60_Y	1.043	0.99
42_R	46_L	1.024	0.99
88_R	91_V	1.022	0.99
46_L	90_L	0.983	0.99
87_V	90_L	0.981	0.99
7_D	107_R	0.961	0.99
77_D	82_S	0.960	0.99
40_R	44_L	0.922	0.98
49_R	67_L	0.912	0.98
19_W	23_A	0.909	0.98
71_D	75_A	0.899	0.98
14_A	18_L	0.894	0.98
19_W	22_L	0.889	0.98
101_G	104_R	0.886	0.98
69_G	83_L	0.886	0.98
16_R	19_W	0.879	0.98
51_L	55_L	0.877	0.98
9_E	16_R	0.876	0.98
50_A	87_V	0.869	0.98
15_A	19_W	0.869	0.98
70_A	74_A	0.851	0.97
80_T	83_L	0.829	0.97
90_L	94_G	0.818	0.97
43_R	47_A	0.812	0.96
8_F	19_W	0.804	0.96
83_L	86_R	0.800	0.96
27_P	30_D	0.798	0.96
23_A	63_I	0.794	0.96
68_F	73_V	0.793	0.96
68_F	83_L	0.789	0.96
63_I	87_V	0.775	0.95
96_A	104_R	0.774	0.95
13_A	31_P	0.755	0.95
73_V	78_W	0.753	0.95
24_G	30_D	0.749	0.94
38_P	75_A	0.738	0.94
60_Y	63_I	0.721	0.93
88_R	92_R	0.715	0.93
93_R	97_L	0.714	0.93
102_Y	105_L	0.711	0.93
22_L	92_R	0.707	0.93
55_L	91_V	0.707	0.93
80_T	85_D	0.701	0.92
27_P	31_P	0.694	0.92
30_D	33_A	0.688	0.92
97_L	105_L	0.679	0.91
43_R	46_L	0.656	0.90
24_G	27_P	0.653	0.89
96_A	100_G	0.647	0.89
11_R	89_R	0.641	0.88
48_L	58_A	0.639	0.88
79_K	83_L	0.633	0.88
16_R	31_P	0.632	0.88
96_A	101_G	0.630	0.88
47_A	84_R	0.630	0.88
20_R	35_P	0.619	0.87
43_R	82_S	0.614	0.86
37_P	40_R	0.609	0.86
37_P	45_I	0.608	0.86
100_G	103_R	0.607	0.86
9_E	13_A	0.605	0.85
15_A	18_L	0.600	0.85
26_R	29_P	0.600	0.85
80_T	93_R	0.599	0.85
31_P	35_P	0.596	0.85
26_R	32_R	0.593	0.84
44_L	85_D	0.589	0.84
38_P	41_R	0.584	0.83
59_S	81_S	0.580	0.83
9_E	19_W	0.567	0.82
43_R	93_R	0.566	0.81
93_R	96_A	0.565	0.81
49_R	56_A	0.563	0.81
7_D	10_A	0.561	0.81
13_A	21_A	0.558	0.81
89_R	94_G	0.549	0.79
6_A	9_E	0.547	0.79
48_L	93_R	0.547	0.79
63_I	91_V	0.547	0.79
10_A	15_A	0.542	0.79
78_W	84_R	0.538	0.78
80_T	105_L	0.537	0.78
49_R	84_R	0.537	0.78
30_D	34_L	0.532	0.77
72_R	79_K	0.532	0.77
85_D	92_R	0.531	0.77
77_D	80_T	0.530	0.77
72_R	78_W	0.527	0.77
26_R	30_D	0.527	0.77
44_L	86_R	0.522	0.76
12_L	15_A	0.522	0.76
71_D	83_L	0.518	0.75
37_P	41_R	0.509	0.74
47_A	50_A	0.506	0.74
85_D	91_V	0.503	0.73
27_P	44_L	0.502	0.73
12_L	17_R	0.502	0.73
72_R	83_L	0.500	0.73
42_R	86_R	0.500	0.73

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
4r3uA	2	0.6355	16	0.887	Contact Map
3korA	2	0.8224	16	0.887	Contact Map
2ns0A	1	0.5701	9.5	0.898	Contact Map
3frwA	2	0.8131	9.4	0.898	Contact Map
2jpcA	1	0.5607	8.6	0.9	Contact Map
1j5yA	4	0.5888	6.3	0.906	Contact Map
1tc3C	1	0.4766	6.1	0.906	Contact Map
1r7jA	2	0.5514	5.7	0.908	Contact Map
1je8A	2	0.5327	5.5	0.909	Contact Map
3fozA	2	0.9439	5.3	0.909	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0052 seconds.