DUF2301 - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

DUF2301 - Uncharacterized integral membrane protein (DUF2301)

PFAM:	PF10063	Sequences: LSLFTIHIYLRPLHRALQLFWLIGCIGSLALALSGPEPLALTVYNQPLTLLGVGPLFAALTGIGFKEAFCFNRLETKLLTPLVPLLLLGHLSGLLPVEVEQVLLGLWAVLFLVFALRKFFQPIPPDIGDKSVFAY	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	135 (135)
Sequences:	532 (344)
Seq/√Len:	29.6
META:	0.682

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
48_L	51_L	5.511	1.00
15_R	18_Q	3.913	1.00
20_F	58_A	3.862	1.00
33_L	39_L	3.489	1.00
1_L	5_T	2.768	1.00
27_G	31_L	2.618	1.00
12_P	16_A	2.581	0.99
75_E	117_R	2.555	0.99
127_I	130_K	2.529	0.99
52_G	55_P	2.526	0.99
6_I	63_I	2.328	0.99
119_F	125_P	2.283	0.99
68_A	72_N	2.270	0.99
42_T	46_Q	2.167	0.98
94_L	109_V	2.146	0.98
120_F	125_P	2.145	0.98
65_F	80_T	1.993	0.97
72_N	77_K	1.902	0.96
79_L	115_A	1.886	0.96
37_E	41_L	1.849	0.95
11_R	15_R	1.807	0.94
122_P	125_P	1.805	0.94
50_L	58_A	1.796	0.94
8_I	17_L	1.694	0.92
114_F	121_Q	1.647	0.91
68_A	77_K	1.568	0.89
99_V	106_L	1.548	0.88
102_V	105_G	1.533	0.88
3_L	8_I	1.526	0.88
107_W	111_F	1.356	0.80
25_C	28_S	1.351	0.80
14_H	17_L	1.333	0.79
2_S	74_L	1.322	0.79
14_H	18_Q	1.302	0.78
126_D	129_D	1.302	0.78
51_L	58_A	1.290	0.77
22_L	90_H	1.258	0.75
4_F	134_A	1.257	0.75
116_L	120_F	1.246	0.74
27_G	55_P	1.239	0.74
14_H	71_F	1.227	0.73
1_L	4_F	1.203	0.72
106_L	109_V	1.192	0.71
98_E	102_V	1.190	0.71
54_G	62_G	1.187	0.71
30_A	92_S	1.172	0.70
1_L	42_T	1.150	0.68
29_L	92_S	1.133	0.67
63_I	134_A	1.127	0.67
34_S	39_L	1.127	0.67
128_G	131_S	1.110	0.65
87_L	104_L	1.091	0.64
23_I	36_P	1.084	0.64
102_V	106_L	1.061	0.62
4_F	51_L	1.044	0.61
16_A	20_F	1.044	0.61
29_L	115_A	1.043	0.61
99_V	102_V	1.043	0.61
66_K	70_C	1.033	0.60
42_T	95_L	1.014	0.58
86_L	100_E	1.009	0.58
97_V	105_G	1.004	0.58
35_G	39_L	1.002	0.57
54_G	58_A	1.002	0.57
19_L	98_E	1.001	0.57
72_N	119_F	0.997	0.57
23_I	31_L	0.986	0.56
17_L	69_F	0.964	0.54
107_W	114_F	0.961	0.54
23_I	99_V	0.958	0.54
29_L	102_V	0.931	0.52
108_A	124_P	0.929	0.52
10_L	13_L	0.926	0.51
46_Q	53_V	0.923	0.51
34_S	42_T	0.913	0.50
45_N	112_L	0.907	0.50
17_L	60_L	0.900	0.49
47_P	63_I	0.893	0.49
5_T	16_A	0.884	0.48
68_A	114_F	0.875	0.47
28_S	32_A	0.872	0.47
67_E	70_C	0.866	0.47
117_R	131_S	0.862	0.46
37_E	43_V	0.846	0.45
2_S	5_T	0.843	0.45
48_L	105_G	0.840	0.45
54_G	59_A	0.839	0.45
106_L	112_L	0.839	0.45
78_L	112_L	0.829	0.44
108_A	116_L	0.827	0.44
33_L	41_L	0.822	0.43
109_V	116_L	0.812	0.43
34_S	92_S	0.810	0.42
54_G	63_I	0.805	0.42
78_L	106_L	0.805	0.42
75_E	84_P	0.803	0.42
2_S	68_A	0.802	0.42
92_S	110_L	0.802	0.42
46_Q	92_S	0.800	0.42
25_C	92_S	0.789	0.41
85_L	109_V	0.788	0.41
28_S	31_L	0.782	0.40
88_L	91_L	0.775	0.40
51_L	92_S	0.765	0.39
90_H	100_E	0.760	0.39
13_L	17_L	0.759	0.39
35_G	42_T	0.758	0.38
11_R	14_H	0.748	0.38
59_A	83_V	0.748	0.38
25_C	56_L	0.744	0.37
64_G	83_V	0.732	0.37
8_I	21_W	0.722	0.36
73_R	76_T	0.721	0.36
64_G	81_P	0.719	0.36
65_F	76_T	0.719	0.36
106_L	122_P	0.706	0.35
45_N	106_L	0.694	0.34
25_C	82_L	0.694	0.34
53_V	58_A	0.686	0.33
45_N	51_L	0.684	0.33
76_T	127_I	0.679	0.33
40_A	74_L	0.678	0.33
37_E	115_A	0.675	0.32
36_P	48_L	0.671	0.32
24_G	62_G	0.670	0.32
68_A	119_F	0.669	0.32
45_N	92_S	0.668	0.32
79_L	83_V	0.665	0.32
68_A	78_L	0.663	0.32
32_A	35_G	0.655	0.31
14_H	73_R	0.650	0.31
93_G	109_V	0.648	0.31
8_I	80_T	0.646	0.31
3_L	21_W	0.641	0.30
119_F	123_I	0.638	0.30
51_L	95_L	0.632	0.30
6_I	9_Y	0.629	0.29
78_L	122_P	0.622	0.29
3_L	13_L	0.618	0.29
8_I	13_L	0.616	0.29
14_H	21_W	0.603	0.28
19_L	30_A	0.598	0.27
124_P	127_I	0.595	0.27
40_A	97_V	0.595	0.27
44_Y	96_P	0.592	0.27
8_I	57_F	0.590	0.27
116_L	125_P	0.589	0.27
30_A	81_P	0.587	0.27
22_L	106_L	0.581	0.26
30_A	127_I	0.581	0.26
13_L	21_W	0.581	0.26
34_S	116_L	0.579	0.26
118_K	126_D	0.577	0.26
71_F	135_Y	0.577	0.26
15_R	43_V	0.576	0.26
30_A	106_L	0.576	0.26
36_P	39_L	0.575	0.26
24_G	89_G	0.570	0.26
26_I	45_N	0.568	0.26
109_V	122_P	0.567	0.25
110_L	122_P	0.566	0.25
65_F	75_E	0.561	0.25
46_Q	81_P	0.561	0.25
68_A	71_F	0.559	0.25
97_V	101_Q	0.558	0.25
30_A	94_L	0.558	0.25
59_A	62_G	0.553	0.25
125_P	132_V	0.552	0.25
31_L	110_L	0.547	0.24
1_L	46_Q	0.547	0.24
92_S	98_E	0.544	0.24
128_G	133_F	0.543	0.24
3_L	133_F	0.542	0.24
10_L	20_F	0.541	0.24
15_R	34_S	0.540	0.24
125_P	133_F	0.538	0.24
35_G	102_V	0.537	0.24
58_A	62_G	0.534	0.24
31_L	35_G	0.534	0.24
99_V	120_F	0.531	0.23
118_K	128_G	0.531	0.23
16_A	98_E	0.531	0.23
31_L	94_L	0.530	0.23
26_I	122_P	0.529	0.23
10_L	22_L	0.528	0.23
55_P	76_T	0.527	0.23
132_V	135_Y	0.526	0.23
15_R	29_L	0.523	0.23
102_V	116_L	0.520	0.23
73_R	77_K	0.520	0.23
28_S	61_T	0.520	0.23
2_S	120_F	0.520	0.23
45_N	109_V	0.519	0.23
67_E	126_D	0.517	0.23
23_I	33_L	0.517	0.23
37_E	45_N	0.509	0.22
18_Q	24_G	0.509	0.22
29_L	33_L	0.508	0.22
22_L	28_S	0.508	0.22
73_R	133_F	0.506	0.22
30_A	109_V	0.502	0.22
75_E	131_S	0.500	0.22

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3rceA	1	0.9111	3	0.957	Contact Map
1floA	3	0.5556	3	0.957	Contact Map
2l6wA	2	0.2815	2.1	0.961	Contact Map
2k4jA	1	0.2889	1.9	0.962	Contact Map
4xk8G	1	0.2815	1.8	0.962	Contact Map
2hqrA	2	0.3333	1.8	0.962	Contact Map
4b09A	2	0.3333	1.6	0.963	Contact Map
2m59A	2	0.2296	1.4	0.964	Contact Map
1q90G	1	0.2222	1.2	0.966	Contact Map
2l16A	1	0.2963	1.2	0.966	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0061 seconds.