DUF2293 - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

DUF2293 - Uncharacterized conserved protein (DUF2293)

PFAM:	PF10056	Sequences: AIRELFPGCPAGEARAIAEHACPKGSGRVGRTAAAPLEERAELAVIAHVRHQTTDYDELLIPGVDRREARRFVADRVDEVLARWR	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	85 (84)
Sequences:	4364 (2607)
Seq/√Len:	284.5
META:	0.915

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
13_E	53_T	4.682	1.00
17_I	45_V	2.981	1.00
76_R	79_E	2.801	1.00
15_R	19_E	2.651	1.00
74_A	78_D	2.635	1.00
42_E	46_I	2.216	1.00
37_L	40_R	2.061	1.00
36_P	40_R	2.052	1.00
55_D	76_R	2.018	1.00
39_E	42_E	2.018	1.00
55_D	58_E	1.992	1.00
65_D	68_E	1.941	1.00
48_H	53_T	1.804	1.00
3_R	14_A	1.754	1.00
5_L	42_E	1.737	1.00
64_V	72_F	1.556	1.00
80_V	83_R	1.534	1.00
48_H	52_Q	1.488	1.00
61_I	69_A	1.477	1.00
7_P	10_P	1.445	1.00
22_C	25_G	1.423	1.00
16_A	52_Q	1.394	1.00
49_V	80_V	1.383	1.00
68_E	72_F	1.370	1.00
55_D	72_F	1.341	1.00
75_D	78_D	1.294	1.00
46_I	81_L	1.291	1.00
6_F	42_E	1.278	1.00
73_V	77_V	1.270	1.00
75_D	79_E	1.247	1.00
67_R	71_R	1.203	1.00
71_R	74_A	1.183	1.00
49_V	77_V	1.180	1.00
18_A	22_C	1.177	1.00
59_L	69_A	1.126	1.00
55_D	59_L	1.126	1.00
60_L	66_R	1.094	1.00
22_C	35_A	1.034	1.00
76_R	80_V	1.024	1.00
31_R	34_A	0.993	1.00
46_I	74_A	0.968	1.00
79_E	83_R	0.964	1.00
62_P	72_F	0.963	1.00
26_S	32_T	0.954	1.00
7_P	11_A	0.945	1.00
80_V	84_W	0.940	1.00
12_G	16_A	0.932	1.00
46_I	78_D	0.927	1.00
19_E	23_P	0.920	1.00
26_S	31_R	0.919	1.00
26_S	30_G	0.909	1.00
29_V	32_T	0.880	1.00
76_R	84_W	0.872	1.00
42_E	85_R	0.855	1.00
20_H	47_A	0.845	1.00
32_T	35_A	0.843	1.00
58_E	62_P	0.843	1.00
27_G	31_R	0.839	1.00
6_F	10_P	0.836	1.00
9_C	17_I	0.836	1.00
49_V	81_L	0.826	1.00
82_A	85_R	0.821	1.00
22_C	48_H	0.812	0.99
53_T	80_V	0.803	0.99
67_R	79_E	0.801	0.99
68_E	71_R	0.792	0.99
47_A	51_H	0.774	0.99
25_G	41_A	0.771	0.99
72_F	76_R	0.759	0.99
21_A	41_A	0.757	0.99
63_G	68_E	0.748	0.99
6_F	9_C	0.741	0.99
21_A	30_G	0.740	0.99
28_R	31_R	0.728	0.99
36_P	39_E	0.728	0.99
20_H	26_S	0.718	0.99
42_E	78_D	0.687	0.98
2_I	14_A	0.684	0.98
29_V	47_A	0.682	0.98
46_I	77_V	0.670	0.98
69_A	73_V	0.665	0.98
25_G	35_A	0.644	0.97
5_L	39_E	0.641	0.97
24_K	35_A	0.628	0.97
60_L	69_A	0.623	0.97
21_A	44_A	0.616	0.97
28_R	44_A	0.611	0.96
44_A	47_A	0.609	0.96
45_V	49_V	0.605	0.96
39_E	78_D	0.600	0.96
15_R	55_D	0.597	0.96
13_E	49_V	0.590	0.96
40_R	43_L	0.581	0.95
6_F	45_V	0.577	0.95
9_C	49_V	0.575	0.95
76_R	85_R	0.573	0.95
13_E	48_H	0.568	0.95
3_R	84_W	0.565	0.95
15_R	18_A	0.559	0.94
10_P	43_L	0.557	0.94
4_E	15_R	0.547	0.94
64_V	68_E	0.546	0.94
4_E	7_P	0.546	0.94
51_H	56_Y	0.545	0.93
51_H	70_R	0.545	0.93
49_V	54_T	0.544	0.93
7_P	60_L	0.542	0.93
15_R	76_R	0.541	0.93
53_T	61_I	0.541	0.93
2_I	18_A	0.538	0.93
25_G	29_V	0.533	0.93
51_H	54_T	0.532	0.93
23_P	48_H	0.529	0.92
18_A	28_R	0.526	0.92
21_A	47_A	0.523	0.92
26_S	29_V	0.522	0.92
60_L	72_F	0.521	0.92
24_K	27_G	0.520	0.92
7_P	15_R	0.519	0.92
9_C	14_A	0.517	0.92
10_P	84_W	0.509	0.91
23_P	66_R	0.509	0.91
69_A	84_W	0.508	0.91
27_G	32_T	0.506	0.91
25_G	31_R	0.500	0.90
63_G	69_A	0.500	0.90

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2ragA	2	0.9647	15.3	0.895	Contact Map
3id7A	1	0.9294	13.9	0.897	Contact Map
4g3oA	1	0.4235	12.4	0.899	Contact Map
1rvgA	3	0.8118	8.8	0.905	Contact Map
3hglA	1	0.4	8.5	0.906	Contact Map
3n9rA	3	0.8118	7.6	0.908	Contact Map
2iswA	2	0.8118	7.3	0.909	Contact Map
2i5gA	2	0.9765	6.6	0.911	Contact Map
4hnzA	5	0.4941	6.5	0.911	Contact Map
1p3qQ	2	0.4353	6.3	0.912	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0043 seconds.