DUF2277 - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

DUF2277 - Uncharacterized conserved protein (DUF2277)

PFAM:	PF10041	Sequences: MCRNIKTLFNFEPPATDEEIRAAALQFVRKVSGFTKPSKANEAAFDRAVDEVAAAARRLLDSLVTTAPPRDREVEAAK	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	78 (78)
Sequences:	21007 (6447)
Seq/√Len:	730.0
META:	0.974

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
51_E	58_R	3.743	1.00
54_A	58_R	2.755	1.00
42_E	46_D	2.481	1.00
17_D	57_R	2.311	1.00
57_R	61_D	2.240	1.00
39_K	42_E	2.158	1.00
18_E	22_A	2.131	1.00
21_R	50_D	2.103	1.00
47_R	62_S	2.017	1.00
47_R	51_E	1.980	1.00
31_V	56_A	1.892	1.00
10_N	13_P	1.865	1.00
51_E	55_A	1.854	1.00
71_D	74_V	1.709	1.00
27_F	56_A	1.702	1.00
9_F	34_F	1.638	1.00
51_E	54_A	1.626	1.00
17_D	21_R	1.552	1.00
74_V	77_A	1.527	1.00
20_I	57_R	1.444	1.00
58_R	62_S	1.440	1.00
34_F	41_N	1.428	1.00
43_A	47_R	1.396	1.00
47_R	58_R	1.376	1.00
21_R	25_L	1.373	1.00
38_S	41_N	1.357	1.00
6_K	11_F	1.254	1.00
4_N	22_A	1.248	1.00
28_V	52_V	1.245	1.00
52_V	55_A	1.167	1.00
36_K	42_E	1.161	1.00
46_D	50_D	1.155	1.00
21_R	53_A	1.151	1.00
50_D	54_A	1.140	1.00
32_S	59_L	1.100	1.00
25_L	46_D	1.087	1.00
40_A	67_A	1.067	1.00
32_S	45_F	1.046	1.00
70_R	75_E	1.044	1.00
73_E	76_A	1.041	1.00
45_F	49_V	1.023	1.00
32_S	35_T	0.954	1.00
48_A	55_A	0.935	1.00
44_A	62_S	0.931	1.00
71_D	75_E	0.911	1.00
61_D	64_V	0.902	1.00
54_A	57_R	0.877	1.00
21_R	24_A	0.872	1.00
40_A	64_V	0.871	1.00
25_L	49_V	0.860	1.00
53_A	56_A	0.850	1.00
20_I	60_L	0.820	1.00
7_T	33_G	0.802	1.00
75_E	78_K	0.800	1.00
53_A	57_R	0.783	1.00
55_A	58_R	0.781	1.00
7_T	11_F	0.770	1.00
7_T	10_N	0.768	1.00
44_A	48_A	0.766	1.00
4_N	23_A	0.766	1.00
51_E	62_S	0.763	1.00
34_F	38_S	0.746	1.00
52_V	56_A	0.740	1.00
35_T	45_F	0.730	1.00
54_A	61_D	0.718	1.00
4_N	11_F	0.714	1.00
55_A	62_S	0.709	1.00
15_A	19_E	0.706	1.00
7_T	70_R	0.704	1.00
10_N	14_P	0.697	1.00
73_E	77_A	0.696	1.00
6_K	10_N	0.694	1.00
17_D	20_I	0.688	1.00
23_A	31_V	0.676	1.00
59_L	63_L	0.674	1.00
6_K	9_F	0.671	1.00
18_E	21_R	0.669	1.00
25_L	35_T	0.663	1.00
10_N	19_E	0.661	1.00
11_F	16_T	0.652	1.00
7_T	22_A	0.651	1.00
71_D	76_A	0.650	1.00
41_N	64_V	0.647	1.00
34_F	63_L	0.644	1.00
68_P	78_K	0.643	1.00
9_F	65_T	0.642	1.00
44_A	63_L	0.640	1.00
7_T	15_A	0.637	1.00
56_A	60_L	0.633	1.00
58_R	61_D	0.594	1.00
43_A	46_D	0.592	1.00
24_A	52_V	0.592	1.00
11_F	15_A	0.579	1.00
25_L	45_F	0.578	1.00
57_R	64_V	0.577	1.00
15_A	31_V	0.567	1.00
15_A	60_L	0.561	1.00
68_P	71_D	0.557	1.00
11_F	19_E	0.548	1.00
57_R	60_L	0.546	1.00
4_N	25_L	0.543	1.00
22_A	31_V	0.539	1.00
40_A	66_T	0.538	1.00
9_F	60_L	0.532	1.00
70_R	73_E	0.531	1.00
4_N	60_L	0.531	1.00
37_P	42_E	0.530	1.00
7_T	31_V	0.529	1.00
64_V	67_A	0.527	1.00
66_T	71_D	0.526	1.00
24_A	32_S	0.517	1.00
34_F	37_P	0.515	1.00
10_N	67_A	0.513	1.00
9_F	63_L	0.513	1.00
9_F	12_E	0.510	1.00
66_T	70_R	0.510	1.00
11_F	14_P	0.500	0.99

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2cwdA	1	0.7821	48.7	0.885	Contact Map
1jf8A	1	0.6538	42.8	0.888	Contact Map
1d1qA	1	0.8077	37.7	0.892	Contact Map
1u2pA	1	0.8462	37.2	0.893	Contact Map
1jl3A	1	0.6795	37	0.893	Contact Map
2wjaA	1	0.7821	30.7	0.897	Contact Map
2wmyA	3	0.7949	26.5	0.9	Contact Map
1p8aA	1	0.7692	25.9	0.901	Contact Map
3n8iA	1	0.8077	25	0.901	Contact Map
2fekA	1	0.8333	23	0.903	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0046 seconds.