DUF2272 - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

DUF2272 - Uncharacterized protein conserved in bacteria (DUF2272)

PFAM:	PF10030	Sequences: ERAEGLWQRVGEYWLDSGLLESAWTGKHDANGAVFPASRDGEAACRAAVIDYAWSAAFISYVMRQAGAGGFPYSPSHADYINAAFRGGASGAYRAEDPEAYAPRPGDLICYGRGRAAPLRFDDLPAGLAGGAGGGFPMHCDIVVAVNVGGPGKLYVIGGNVDQAVTMRHLPLTADGRLAGPPQQSGGCPGCTPGADGACSDNRQPWFVLLQL	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	212 (191)
Sequences:	543 (326)
Seq/√Len:	23.6
META:	0.856

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
81_I	138_M	5.041	1.00
156_V	168_R	4.758	1.00
74_S	79_D	4.287	1.00
141_D	156_V	4.044	1.00
141_D	168_R	3.783	1.00
97_D	122_D	3.543	1.00
180_G	196_D	2.758	0.99
96_E	211_Q	2.676	0.99
120_R	123_D	2.235	0.97
172_L	200_S	2.183	0.96
83_A	89_A	2.103	0.95
173_T	179_A	2.092	0.95
87_G	91_G	2.032	0.94
20_L	30_A	1.979	0.94
138_M	163_Q	1.975	0.94
15_L	19_L	1.942	0.93
76_S	79_D	1.895	0.92
173_T	177_R	1.894	0.92
66_A	144_V	1.844	0.91
114_G	126_A	1.759	0.89
96_E	101_Y	1.755	0.89
112_G	116_A	1.751	0.89
62_V	142_I	1.734	0.88
110_C	140_C	1.680	0.86
201_D	204_Q	1.672	0.86
203_R	207_F	1.630	0.85
208_V	211_Q	1.624	0.84
199_C	202_N	1.618	0.84
141_D	166_T	1.609	0.84
146_V	149_G	1.607	0.84
95_A	208_V	1.600	0.84
74_S	116_A	1.600	0.84
150_G	157_I	1.579	0.83
112_G	207_F	1.553	0.82
126_A	129_A	1.535	0.81
81_I	136_F	1.466	0.78
209_L	212_L	1.454	0.77
98_P	109_I	1.433	0.76
16_D	116_A	1.433	0.76
59_I	142_I	1.432	0.76
154_L	200_S	1.415	0.75
9_R	13_Y	1.411	0.75
50_I	72_P	1.401	0.74
30_A	157_I	1.356	0.72
104_R	211_Q	1.354	0.72
31_N	39_R	1.339	0.71
161_V	208_V	1.329	0.70
109_I	144_V	1.324	0.70
64_R	73_Y	1.315	0.69
7_W	10_V	1.310	0.69
17_S	51_D	1.306	0.69
121_F	124_L	1.299	0.69
147_N	151_P	1.283	0.68
96_E	104_R	1.279	0.67
45_C	48_A	1.274	0.67
154_L	207_F	1.273	0.67
25_T	28_H	1.271	0.67
10_V	14_W	1.271	0.67
59_I	157_I	1.255	0.66
59_I	108_L	1.233	0.64
39_R	51_D	1.231	0.64
74_S	153_K	1.229	0.64
60_S	203_R	1.202	0.62
145_A	155_Y	1.178	0.61
17_S	76_S	1.176	0.61
121_F	125_P	1.162	0.60
124_L	127_G	1.150	0.59
112_G	163_Q	1.147	0.59
137_P	208_V	1.145	0.59
88_G	91_G	1.143	0.58
18_G	22_S	1.131	0.58
60_S	116_A	1.126	0.57
202_N	205_P	1.125	0.57
207_F	212_L	1.119	0.57
33_A	38_S	1.119	0.57
83_A	164_A	1.117	0.57
112_G	119_L	1.115	0.56
168_R	204_Q	1.113	0.56
142_I	176_G	1.099	0.55
51_D	168_R	1.087	0.55
197_G	201_D	1.084	0.54
200_S	204_Q	1.083	0.54
8_Q	11_G	1.080	0.54
111_Y	168_R	1.080	0.54
146_V	150_G	1.074	0.54
9_R	12_E	1.062	0.53
85_F	121_F	1.035	0.51
10_V	13_Y	1.029	0.50
27_K	35_F	1.027	0.50
81_I	154_L	1.026	0.50
154_L	172_L	1.014	0.49
17_S	60_S	1.014	0.49
53_A	162_D	1.011	0.49
74_S	162_D	1.005	0.49
201_D	209_L	0.990	0.48
71_F	106_G	0.985	0.47
58_F	140_C	0.977	0.47
29_D	35_F	0.977	0.47
85_F	122_D	0.972	0.46
19_L	75_P	0.968	0.46
131_G	134_G	0.961	0.46
59_I	126_A	0.948	0.45
196_D	204_Q	0.948	0.45
65_Q	166_T	0.942	0.44
97_D	173_T	0.939	0.44
76_S	128_L	0.934	0.44
16_D	21_E	0.932	0.44
111_Y	166_T	0.927	0.43
197_G	200_S	0.925	0.43
150_G	174_A	0.924	0.43
28_H	32_G	0.924	0.43
20_L	51_D	0.921	0.43
61_Y	68_A	0.920	0.43
50_I	148_V	0.915	0.42
38_S	118_P	0.914	0.42
108_L	142_I	0.910	0.42
94_R	211_Q	0.906	0.42
52_Y	67_G	0.904	0.42
200_S	207_F	0.900	0.41
145_A	177_R	0.897	0.41
68_A	73_Y	0.891	0.41
5_G	12_E	0.891	0.41
49_V	132_A	0.884	0.40
86_R	91_G	0.884	0.40
6_L	12_E	0.884	0.40
5_G	25_T	0.881	0.40
16_D	19_L	0.880	0.40
117_A	135_G	0.879	0.40
78_A	137_P	0.877	0.40
31_N	166_T	0.875	0.40
86_R	89_A	0.870	0.39
8_Q	41_G	0.869	0.39
5_G	11_G	0.863	0.39
206_W	210_L	0.860	0.39
112_G	138_M	0.858	0.39
51_D	74_S	0.855	0.38
163_Q	203_R	0.853	0.38
121_F	208_V	0.846	0.38
63_M	142_I	0.839	0.37
112_G	203_R	0.835	0.37
57_A	80_Y	0.834	0.37
111_Y	204_Q	0.831	0.37
138_M	207_F	0.828	0.37
26_G	52_Y	0.825	0.36
89_A	94_R	0.825	0.36
47_A	125_P	0.824	0.36
81_I	181_P	0.817	0.36
41_G	114_G	0.811	0.36
173_T	200_S	0.808	0.35
38_S	161_V	0.806	0.35
9_R	14_W	0.804	0.35
51_D	161_V	0.802	0.35
120_R	124_L	0.801	0.35
47_A	180_G	0.800	0.35
83_A	162_D	0.797	0.35
115_R	118_P	0.796	0.35
155_Y	204_Q	0.795	0.34
36_P	39_R	0.792	0.34
78_A	127_G	0.790	0.34
47_A	61_Y	0.787	0.34
37_A	40_D	0.781	0.34
174_A	179_A	0.780	0.34
24_W	164_A	0.777	0.33
87_G	90_S	0.774	0.33
33_A	78_A	0.773	0.33
207_F	211_Q	0.766	0.33
70_G	104_R	0.755	0.32
58_F	165_V	0.750	0.32
17_S	203_R	0.745	0.31
176_G	180_G	0.744	0.31
16_D	22_S	0.744	0.31
64_R	117_A	0.744	0.31
64_R	173_T	0.743	0.31
12_E	16_D	0.740	0.31
95_A	211_Q	0.740	0.31
174_A	200_S	0.739	0.31
46_R	51_D	0.736	0.31
121_F	211_Q	0.717	0.30
89_A	100_A	0.715	0.30
49_V	78_A	0.713	0.29
93_Y	210_L	0.713	0.29
112_G	118_P	0.711	0.29
81_I	178_L	0.711	0.29
51_D	166_T	0.708	0.29
76_S	126_A	0.695	0.28
19_L	22_S	0.686	0.28
170_L	204_Q	0.684	0.28
26_G	40_D	0.675	0.27
141_D	162_D	0.674	0.27
94_R	104_R	0.671	0.27
119_L	168_R	0.669	0.27
174_A	178_L	0.668	0.27
152_G	173_T	0.667	0.27
73_Y	95_A	0.667	0.27
86_R	175_D	0.666	0.27
97_D	177_R	0.666	0.27
33_A	39_R	0.657	0.26
49_V	74_S	0.657	0.26
31_N	51_D	0.654	0.26
85_F	128_L	0.653	0.26
19_L	23_A	0.652	0.26
199_C	205_P	0.651	0.26
72_P	131_G	0.646	0.26
7_W	18_G	0.644	0.26
86_R	196_D	0.644	0.26
53_A	164_A	0.641	0.25
72_P	83_A	0.638	0.25
5_G	8_Q	0.637	0.25
149_G	198_A	0.634	0.25
85_F	145_A	0.631	0.25
86_R	90_S	0.631	0.25
116_A	126_A	0.630	0.25
113_R	158_G	0.627	0.25
60_S	153_K	0.626	0.25
148_V	151_P	0.625	0.25
49_V	61_Y	0.612	0.24
106_G	113_R	0.610	0.24
15_L	34_V	0.609	0.24
23_A	30_A	0.606	0.24
138_M	181_P	0.604	0.24
58_F	110_C	0.602	0.23
100_A	181_P	0.600	0.23
94_R	101_Y	0.599	0.23
175_D	178_L	0.597	0.23
111_Y	178_L	0.596	0.23
176_G	179_A	0.593	0.23
181_P	198_A	0.591	0.23
8_Q	30_A	0.589	0.23
12_E	40_D	0.589	0.23
106_G	140_C	0.586	0.23
173_T	176_G	0.586	0.23
23_A	26_G	0.583	0.22
142_I	171_P	0.582	0.22
99_E	171_P	0.581	0.22
82_N	125_P	0.580	0.22
6_L	11_G	0.579	0.22
15_L	20_L	0.578	0.22
63_M	80_Y	0.577	0.22
19_L	51_D	0.575	0.22
85_F	200_S	0.570	0.22
97_D	179_A	0.568	0.22
28_H	34_V	0.567	0.22
60_S	163_Q	0.565	0.22
18_G	79_D	0.565	0.22
199_C	207_F	0.565	0.22
29_D	33_A	0.564	0.22
74_S	149_G	0.564	0.22
90_S	175_D	0.563	0.22
62_V	117_A	0.562	0.21
61_Y	157_I	0.561	0.21
24_W	27_K	0.559	0.21
163_Q	204_Q	0.558	0.21
6_L	17_S	0.558	0.21
148_V	166_T	0.557	0.21
57_A	83_A	0.552	0.21
63_M	124_L	0.551	0.21
79_D	128_L	0.549	0.21
156_V	178_L	0.548	0.21
92_A	211_Q	0.545	0.21
50_I	81_I	0.545	0.21
38_S	94_R	0.545	0.21
15_L	79_D	0.542	0.21
23_A	29_D	0.542	0.21
70_G	123_D	0.540	0.20
176_G	197_G	0.540	0.20
20_L	127_G	0.539	0.20
163_Q	166_T	0.535	0.20
56_A	106_G	0.535	0.20
155_Y	169_H	0.533	0.20
132_A	197_G	0.532	0.20
22_S	37_A	0.531	0.20
98_P	111_Y	0.530	0.20
145_A	149_G	0.529	0.20
33_A	114_G	0.528	0.20
204_Q	212_L	0.528	0.20
49_V	166_T	0.527	0.20
112_G	136_F	0.525	0.20
31_N	37_A	0.522	0.20
145_A	167_M	0.510	0.19
92_A	98_P	0.510	0.19
72_P	197_G	0.509	0.19
90_S	93_Y	0.507	0.19
46_R	84_A	0.503	0.19
59_I	141_D	0.503	0.19
123_D	205_P	0.503	0.19
85_F	154_L	0.500	0.19

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3vpiA	1	0.6179	78.7	0.941	Contact Map
2if6A	1	0.4434	42.6	0.954	Contact Map
4cgkA	3	0.6462	39.1	0.955	Contact Map
4ct3A	4	0.7075	23.5	0.959	Contact Map
4hz9A	1	0.5283	20.7	0.96	Contact Map
4hpeA	1	0.6509	18.5	0.961	Contact Map
4lj1A	1	0.5991	18.4	0.961	Contact Map
4q4gX	1	0.6038	15.2	0.963	Contact Map
4fdyA	1	0.6415	12.4	0.964	Contact Map
2k3aA	1	0.6226	8.5	0.967	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0071 seconds.