DUF2269 - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

DUF2269 - Predicted integral membrane protein (DUF2269)

PFAM:	PF10027	Sequences: LLLKFLHVLGAVVLFGGGLGIAFFMLRARRSGDPAAIAAVARLVVRADWLFTAPAVLLQLVTGLWLAHLAGWPLGTGWILASLVLYVVAGALGLPVVWLQIRLRRLAEAAAAAGAPLPPEYRRLARRWFALGWPAFLLLLAIVWLMVAKP	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	150 (149)
Sequences:	12952 (9697)
Seq/√Len:	794.4
META:	0.917

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
64_L	68_H	3.387	1.00
144_W	148_A	3.178	1.00
77_G	81_A	2.602	1.00
3_L	65_W	2.474	1.00
10_G	58_L	2.354	1.00
99_L	103_L	2.331	1.00
65_W	69_L	2.270	1.00
5_F	144_W	2.188	1.00
109_A	113_A	2.092	1.00
80_L	84_V	2.046	1.00
36_A	39_A	2.041	1.00
46_R	50_L	1.893	1.00
6_L	62_T	1.830	1.00
12_V	143_V	1.771	1.00
91_A	95_P	1.771	1.00
108_E	112_A	1.758	1.00
120_E	124_L	1.753	1.00
100_Q	104_R	1.742	1.00
67_A	79_I	1.690	1.00
101_I	105_R	1.677	1.00
73_P	76_T	1.663	1.00
82_S	145_L	1.649	1.00
25_M	29_R	1.647	1.00
100_Q	103_L	1.634	1.00
82_S	146_M	1.615	1.00
76_T	80_L	1.599	1.00
99_L	102_R	1.596	1.00
90_G	94_L	1.584	1.00
45_V	49_W	1.578	1.00
21_I	24_F	1.521	1.00
141_A	145_L	1.506	1.00
60_L	86_Y	1.505	1.00
94_L	98_W	1.493	1.00
58_L	62_T	1.466	1.00
129_F	133_W	1.452	1.00
122_R	125_A	1.444	1.00
126_R	130_A	1.388	1.00
75_G	80_L	1.367	1.00
92_L	131_L	1.363	1.00
85_L	138_L	1.354	1.00
102_R	106_L	1.352	1.00
79_I	83_L	1.351	1.00
31_S	36_A	1.345	1.00
102_R	105_R	1.330	1.00
77_G	80_L	1.325	1.00
8_V	11_A	1.316	1.00
101_I	104_R	1.313	1.00
104_R	108_E	1.306	1.00
33_D	36_A	1.305	1.00
29_R	121_Y	1.293	1.00
10_G	62_T	1.290	1.00
133_W	137_L	1.279	1.00
27_R	43_L	1.255	1.00
123_R	127_R	1.241	1.00
130_A	133_W	1.238	1.00
105_R	108_E	1.230	1.00
61_V	65_W	1.226	1.00
103_L	107_A	1.182	1.00
5_F	9_L	1.177	1.00
39_A	43_L	1.168	1.00
101_I	106_L	1.168	1.00
99_L	127_R	1.164	1.00
17_G	20_G	1.162	1.00
34_P	38_A	1.140	1.00
89_A	138_L	1.139	1.00
99_L	124_L	1.132	1.00
119_P	123_R	1.132	1.00
109_A	112_A	1.123	1.00
105_R	109_A	1.113	1.00
118_P	121_Y	1.111	1.00
82_S	142_I	1.104	1.00
4_K	66_L	1.101	1.00
127_R	131_L	1.091	1.00
72_W	76_T	1.085	1.00
95_P	98_W	1.071	1.00
55_A	58_L	1.067	1.00
65_W	68_H	1.061	1.00
11_A	59_Q	1.056	1.00
127_R	130_A	1.046	1.00
8_V	147_V	1.037	1.00
13_V	55_A	1.033	1.00
117_L	120_E	1.030	1.00
84_V	88_V	1.020	1.00
5_F	148_A	1.016	1.00
60_L	64_L	1.012	1.00
106_L	110_A	1.005	1.00
39_A	42_R	1.005	1.00
121_Y	125_A	1.003	1.00
34_P	37_I	0.999	1.00
62_T	66_L	0.995	1.00
120_E	123_R	0.994	1.00
64_L	83_L	0.989	1.00
102_R	120_E	0.988	1.00
59_Q	62_T	0.979	1.00
130_A	134_P	0.978	1.00
93_G	98_W	0.975	1.00
125_A	129_F	0.967	1.00
123_R	126_R	0.954	1.00
67_A	74_L	0.933	1.00
87_V	91_A	0.933	1.00
104_R	107_A	0.929	1.00
6_L	10_G	0.921	1.00
81_A	145_L	0.913	1.00
111_A	114_G	0.907	1.00
119_P	122_R	0.894	1.00
103_L	125_A	0.892	1.00
85_L	142_I	0.890	1.00
68_H	74_L	0.884	1.00
43_L	46_R	0.880	1.00
62_T	65_W	0.855	1.00
27_R	31_S	0.855	1.00
35_A	39_A	0.845	1.00
12_V	15_F	0.844	1.00
99_L	104_R	0.840	1.00
118_P	122_R	0.814	1.00
80_L	83_L	0.814	1.00
50_L	54_P	0.812	1.00
60_L	83_L	0.809	1.00
134_P	138_L	0.792	1.00
67_A	70_A	0.792	1.00
98_W	102_R	0.785	1.00
134_P	137_L	0.781	1.00
11_A	143_V	0.779	1.00
74_L	83_L	0.776	1.00
29_R	125_A	0.774	1.00
26_L	30_R	0.771	1.00
102_R	124_L	0.767	1.00
10_G	55_A	0.767	1.00
91_A	94_L	0.762	1.00
101_I	108_E	0.753	1.00
42_R	108_E	0.737	1.00
132_G	135_A	0.736	1.00
78_W	82_S	0.733	1.00
5_F	140_L	0.731	1.00
24_F	43_L	0.728	1.00
51_F	54_P	0.720	1.00
27_R	30_R	0.719	1.00
145_L	150_P	0.712	1.00
131_L	135_A	0.708	1.00
93_G	97_V	0.706	1.00
107_A	110_A	0.702	1.00
106_L	109_A	0.701	1.00
13_V	17_G	0.700	1.00
120_E	126_R	0.699	1.00
128_W	132_G	0.698	1.00
83_L	87_V	0.695	1.00
99_L	106_L	0.694	1.00
18_G	22_A	0.692	1.00
122_R	126_R	0.692	1.00
89_A	135_A	0.690	1.00
103_L	108_E	0.690	1.00
9_L	140_L	0.687	1.00
86_Y	89_A	0.686	1.00
27_R	46_R	0.686	1.00
3_L	69_L	0.677	1.00
16_G	19_L	0.676	1.00
52_T	55_A	0.670	1.00
40_V	43_L	0.666	1.00
92_L	95_P	0.664	1.00
22_A	136_F	0.661	1.00
98_W	101_I	0.661	1.00
103_L	106_L	0.661	1.00
32_G	122_R	0.657	1.00
128_W	131_L	0.655	1.00
72_W	149_K	0.655	1.00
28_A	40_V	0.654	1.00
42_R	46_R	0.654	1.00
53_A	56_V	0.652	1.00
19_L	22_A	0.651	1.00
93_G	96_V	0.649	1.00
13_V	16_G	0.647	1.00
4_K	8_V	0.640	1.00
120_E	125_A	0.635	1.00
133_W	136_F	0.632	1.00
66_L	70_A	0.632	1.00
108_E	111_A	0.629	1.00
38_A	42_R	0.628	1.00
56_V	90_G	0.628	1.00
81_A	141_A	0.626	1.00
18_G	21_I	0.623	1.00
142_I	145_L	0.623	1.00
26_L	29_R	0.619	1.00
57_L	61_V	0.615	1.00
141_A	144_W	0.613	1.00
14_L	18_G	0.612	1.00
53_A	57_L	0.608	1.00
48_D	53_A	0.606	1.00
14_L	17_G	0.597	1.00
117_L	122_R	0.595	1.00
28_A	31_S	0.593	1.00
64_L	74_L	0.591	1.00
52_T	56_V	0.586	1.00
20_G	24_F	0.585	1.00
20_G	47_A	0.582	1.00
56_V	139_L	0.580	1.00
68_H	71_G	0.579	1.00
45_V	48_D	0.577	1.00
59_Q	66_L	0.576	1.00
13_V	19_L	0.572	1.00
6_L	58_L	0.567	1.00
24_F	40_V	0.566	1.00
85_L	145_L	0.565	1.00
64_L	67_A	0.563	1.00
44_V	48_D	0.557	1.00
36_A	40_V	0.555	1.00
106_L	120_E	0.551	1.00
135_A	139_L	0.548	1.00
110_A	118_P	0.547	1.00
15_F	19_L	0.545	1.00
110_A	113_A	0.538	1.00
10_G	59_Q	0.536	1.00
100_Q	107_A	0.529	1.00
128_W	135_A	0.523	1.00
2_L	148_A	0.518	1.00
117_L	121_Y	0.513	1.00
81_A	85_L	0.509	1.00
137_L	141_A	0.507	1.00
34_P	41_A	0.506	1.00
89_A	139_L	0.504	1.00
104_R	109_A	0.504	1.00
17_G	52_T	0.503	1.00
55_A	59_Q	0.503	1.00
119_P	124_L	0.502	1.00
35_A	38_A	0.500	1.00

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2xq2A	2	0.6467	27.4	0.88	Contact Map
3mk7C	2	0.5067	14.4	0.894	Contact Map
4gd3A	2	0.6267	9.7	0.902	Contact Map
4c7rA	3	0.1733	7.3	0.908	Contact Map
3dh4A	3	0.6733	7.2	0.908	Contact Map
2rddB	1	0.1533	5.9	0.912	Contact Map
3o7qA	1	0.9467	5.7	0.912	Contact Map
4mt1A	3	0.7133	4.8	0.915	Contact Map
4w6vA	1	0.66	4.7	0.915	Contact Map
4hkrA	3	0.6133	4.3	0.917	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0063 seconds.