DUF2251 - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

DUF2251 - Uncharacterized protein conserved in bacteria (DUF2251)

PFAM:	PF10008	Sequences: ESDSPEGPYAVVFEDDGETGYFYALDRSREGQPILDALHIYNVADVTDRDRPSDVEIVWSEDGLKAALLINGYPHAVFDFAARRGYCRTGFPN	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	93 (90)
Sequences:	1088 (837)
Seq/√Len:	88.2
META:	0.947

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
67_A	74_P	4.651	1.00
11_V	66_A	3.772	1.00
78_F	85_G	3.479	1.00
15_D	41_Y	2.439	1.00
3_D	10_A	2.434	1.00
20_G	41_Y	2.211	1.00
26_D	29_R	2.176	1.00
39_H	42_N	2.108	1.00
4_S	63_G	2.098	1.00
58_V	67_A	2.043	1.00
22_F	68_L	1.804	1.00
87_C	90_G	1.789	1.00
64_L	81_A	1.786	1.00
22_F	57_I	1.700	1.00
24_A	85_G	1.666	1.00
10_A	27_R	1.642	1.00
22_F	78_F	1.466	0.99
23_Y	34_I	1.456	0.99
5_P	63_G	1.450	0.99
29_R	35_L	1.400	0.99
79_D	82_A	1.388	0.99
14_E	19_T	1.354	0.99
24_A	80_F	1.295	0.99
25_L	33_P	1.279	0.99
62_D	65_K	1.258	0.98
58_V	69_L	1.224	0.98
7_G	35_L	1.219	0.98
57_I	68_L	1.180	0.97
36_D	80_F	1.166	0.97
15_D	80_F	1.161	0.97
38_L	87_C	1.151	0.97
8_P	28_S	1.142	0.97
67_A	72_G	1.130	0.97
12_V	37_A	1.113	0.96
46_V	71_N	1.085	0.96
41_Y	80_F	1.064	0.95
69_L	72_G	1.053	0.95
14_E	23_Y	1.041	0.95
51_R	54_D	1.041	0.95
40_I	76_A	1.037	0.95
47_T	53_S	1.018	0.94
40_I	68_L	1.009	0.94
21_Y	91_F	1.006	0.94
19_T	37_A	1.004	0.94
46_V	73_Y	0.997	0.93
56_E	69_L	0.990	0.93
84_R	90_G	0.981	0.93
15_D	20_G	0.975	0.93
60_S	65_K	0.948	0.92
46_V	75_H	0.947	0.92
7_G	10_A	0.940	0.91
28_S	55_V	0.928	0.91
48_D	70_I	0.927	0.91
4_S	7_G	0.925	0.91
42_N	89_T	0.924	0.91
60_S	64_L	0.921	0.90
73_Y	88_R	0.916	0.90
47_T	50_D	0.901	0.89
47_T	51_R	0.897	0.89
19_T	42_N	0.894	0.89
44_A	51_R	0.891	0.89
39_H	89_T	0.881	0.88
8_P	72_G	0.869	0.88
11_V	25_L	0.869	0.88
42_N	45_D	0.867	0.88
22_F	60_S	0.836	0.86
84_R	89_T	0.835	0.86
53_S	71_N	0.826	0.85
12_V	32_Q	0.819	0.84
9_Y	64_L	0.814	0.84
14_E	37_A	0.795	0.83
71_N	75_H	0.785	0.82
65_K	79_D	0.780	0.81
81_A	89_T	0.775	0.81
52_P	56_E	0.767	0.80
78_F	83_R	0.730	0.77
36_D	71_N	0.714	0.75
31_G	37_A	0.708	0.75
68_L	76_A	0.708	0.75
38_L	58_V	0.707	0.75
24_A	78_F	0.707	0.75
6_E	63_G	0.702	0.74
12_V	66_A	0.700	0.74
22_F	76_A	0.698	0.74
25_L	32_Q	0.692	0.73
28_S	82_A	0.691	0.73
49_R	71_N	0.681	0.72
11_V	74_P	0.681	0.72
77_V	86_Y	0.681	0.72
26_D	80_F	0.678	0.72
37_A	76_A	0.678	0.72
58_V	72_G	0.669	0.71
9_Y	25_L	0.664	0.70
44_A	81_A	0.658	0.69
30_E	57_I	0.654	0.69
56_E	72_G	0.651	0.69
69_L	74_P	0.648	0.68
23_Y	37_A	0.647	0.68
5_P	45_D	0.639	0.67
10_A	35_L	0.628	0.66
52_P	57_I	0.623	0.65
66_A	83_R	0.614	0.64
79_D	84_R	0.612	0.64
18_E	31_G	0.612	0.64
4_S	20_G	0.607	0.63
11_V	78_F	0.604	0.63
43_V	52_P	0.604	0.63
67_A	84_R	0.593	0.61
11_V	24_A	0.592	0.61
12_V	33_P	0.590	0.61
10_A	33_P	0.586	0.60
19_T	23_Y	0.584	0.60
27_R	35_L	0.575	0.59
38_L	90_G	0.569	0.58
53_S	70_I	0.567	0.58
18_E	50_D	0.562	0.57
66_A	76_A	0.562	0.57
40_I	70_I	0.557	0.57
67_A	90_G	0.553	0.56
51_R	73_Y	0.553	0.56
37_A	91_F	0.550	0.56
20_G	81_A	0.544	0.55
4_S	90_G	0.539	0.54
16_D	19_T	0.536	0.54
82_A	86_Y	0.535	0.54
60_S	75_H	0.535	0.54
65_K	77_V	0.532	0.53
38_L	76_A	0.530	0.53
83_R	90_G	0.529	0.53
30_E	50_D	0.515	0.51
36_D	92_P	0.510	0.50
7_G	24_A	0.503	0.49
43_V	46_V	0.502	0.49
62_D	71_N	0.500	0.49
61_E	72_G	0.500	0.49

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3pe7A	1	0.871	64.4	0.879	Contact Map
2bklA	1	0.9355	58.3	0.884	Contact Map
2madH	2	0.8602	56	0.885	Contact Map
4a5sA	2	0.8602	51	0.889	Contact Map
2hqsA	2	0.871	47.5	0.891	Contact Map
3c5mA	1	0.871	45.1	0.893	Contact Map
1yr2A	1	0.8817	43.8	0.893	Contact Map
2ecfA	2	0.9032	39.9	0.896	Contact Map
1jmxB	2	0.8172	39.6	0.896	Contact Map
3iujA	1	0.9247	39.6	0.896	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.005 seconds.