DUF2243 - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

DUF2243 - Predicted membrane protein (DUF2243)

PFAM:	PF10002	Sequences: AGILLGLGLGGFVDGIVLHQILQWHHMLSSGYPPTTVSGLEVNTLWDGLFHAATWLATVAGLFLLWRARRRGRVAWSGRRLWGGLLLGWGLFNLVEGLVDHQLLGIHHVRYGPNPLPWDLGFLAFGALLLVAGWLLLRR	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	139 (138)
Sequences:	2107 (1558)
Seq/√Len:	132.6
META:	0.727

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
116_L	120_L	3.444	1.00
11_G	54_T	3.091	1.00
112_G	115_P	2.975	1.00
36_T	39_G	2.559	1.00
29_S	34_P	2.505	1.00
28_L	46_W	2.484	1.00
2_G	84_G	2.335	1.00
108_H	119_D	2.324	1.00
120_L	124_A	2.323	1.00
7_L	57_A	2.196	1.00
87_L	130_L	2.168	1.00
24_W	110_R	2.136	1.00
117_P	121_G	2.041	1.00
81_L	85_L	1.980	1.00
125_F	129_L	1.954	1.00
13_V	55_W	1.942	1.00
69_R	76_W	1.934	1.00
111_Y	115_P	1.852	1.00
12_F	51_H	1.822	1.00
78_G	82_W	1.792	1.00
116_L	119_D	1.595	1.00
21_I	52_A	1.594	1.00
38_S	42_V	1.575	1.00
45_L	49_L	1.563	1.00
26_H	40_L	1.539	1.00
83_G	137_L	1.517	1.00
23_Q	45_L	1.516	1.00
94_L	130_L	1.503	1.00
4_L	60_A	1.461	1.00
96_E	102_Q	1.458	1.00
23_Q	44_T	1.450	1.00
131_V	135_L	1.446	1.00
34_P	39_G	1.438	1.00
89_W	129_L	1.419	1.00
56_L	60_A	1.395	1.00
86_L	132_A	1.391	1.00
9_L	85_L	1.390	1.00
97_G	122_F	1.361	1.00
10_G	89_W	1.321	1.00
40_L	44_T	1.318	1.00
110_R	118_W	1.312	1.00
9_L	59_V	1.308	1.00
12_F	58_T	1.299	1.00
13_V	52_A	1.283	1.00
30_S	111_Y	1.239	1.00
46_W	49_L	1.235	1.00
7_L	91_L	1.232	1.00
95_V	100_D	1.226	1.00
18_L	24_W	1.224	1.00
20_Q	51_H	1.187	0.99
100_D	106_I	1.180	0.99
31_G	106_I	1.180	0.99
9_L	58_T	1.178	0.99
67_R	70_R	1.174	0.99
21_I	49_L	1.167	0.99
23_Q	41_E	1.164	0.99
5_L	61_G	1.163	0.99
128_L	132_A	1.148	0.99
67_R	71_R	1.138	0.99
59_V	63_F	1.109	0.99
14_D	19_H	1.109	0.99
84_G	137_L	1.097	0.99
102_Q	105_G	1.087	0.99
98_L	102_Q	1.086	0.99
112_G	117_P	1.084	0.99
94_L	126_G	1.077	0.99
12_F	55_W	1.071	0.99
12_F	20_Q	1.067	0.99
87_L	134_W	1.063	0.99
5_L	62_L	1.063	0.99
94_L	127_A	1.055	0.99
55_W	58_T	1.048	0.99
30_S	105_G	1.039	0.99
15_G	20_Q	1.018	0.98
27_M	100_D	1.012	0.98
66_W	69_R	1.009	0.98
113_P	117_P	0.997	0.98
93_N	97_G	0.979	0.98
38_S	41_E	0.969	0.98
8_G	58_T	0.968	0.98
114_N	117_P	0.967	0.98
93_N	122_F	0.967	0.98
31_G	39_G	0.967	0.98
1_A	81_L	0.966	0.98
34_P	37_V	0.964	0.98
1_A	5_L	0.957	0.97
125_F	128_L	0.956	0.97
135_L	138_R	0.945	0.97
26_H	44_T	0.936	0.97
35_T	39_G	0.936	0.97
87_L	137_L	0.934	0.97
97_G	103_L	0.926	0.97
108_H	115_P	0.915	0.97
42_V	46_W	0.914	0.97
87_L	91_L	0.907	0.97
4_L	57_A	0.905	0.96
53_A	56_L	0.880	0.96
96_E	109_V	0.876	0.96
12_F	15_G	0.873	0.96
27_M	96_E	0.861	0.95
126_G	129_L	0.850	0.95
17_V	22_L	0.847	0.95
134_W	137_L	0.846	0.95
112_G	116_L	0.842	0.95
71_R	74_V	0.836	0.95
2_G	81_L	0.818	0.94
70_R	74_V	0.815	0.94
121_G	124_A	0.810	0.94
94_L	123_L	0.804	0.93
21_I	45_L	0.801	0.93
113_P	116_L	0.798	0.93
110_R	115_P	0.794	0.93
53_A	57_A	0.791	0.93
61_G	81_L	0.787	0.93
12_F	50_F	0.775	0.92
96_E	122_F	0.771	0.92
12_F	54_T	0.745	0.90
32_Y	42_V	0.745	0.90
33_P	39_G	0.743	0.90
94_L	125_F	0.743	0.90
110_R	114_N	0.735	0.90
131_V	134_W	0.730	0.89
37_V	40_L	0.729	0.89
61_G	65_L	0.724	0.89
64_L	67_R	0.719	0.89
63_F	82_W	0.716	0.89
69_R	72_G	0.714	0.88
69_R	73_R	0.706	0.88
78_G	81_L	0.704	0.88
118_W	121_G	0.695	0.87
17_V	21_I	0.695	0.87
3_I	91_L	0.694	0.87
92_F	97_G	0.692	0.87
17_V	52_A	0.688	0.87
102_Q	115_P	0.685	0.86
32_Y	36_T	0.684	0.86
109_V	123_L	0.681	0.86
16_I	23_Q	0.679	0.86
93_N	105_G	0.674	0.85
37_V	44_T	0.673	0.85
131_V	138_R	0.667	0.85
65_L	69_R	0.664	0.85
99_V	102_Q	0.662	0.84
120_L	127_A	0.654	0.84
63_F	67_R	0.654	0.84
15_G	51_H	0.654	0.84
63_F	135_L	0.647	0.83
12_F	16_I	0.646	0.83
29_S	46_W	0.646	0.83
70_R	76_W	0.642	0.83
31_G	35_T	0.642	0.83
29_S	37_V	0.637	0.82
28_L	34_P	0.637	0.82
97_G	100_D	0.635	0.82
32_Y	39_G	0.635	0.82
69_R	81_L	0.635	0.82
96_E	100_D	0.632	0.82
93_N	100_D	0.629	0.81
90_G	94_L	0.626	0.81
5_L	81_L	0.622	0.81
19_H	51_H	0.615	0.80
96_E	123_L	0.613	0.80
39_G	42_V	0.612	0.79
41_E	44_T	0.603	0.78
66_W	81_L	0.602	0.78
54_T	58_T	0.594	0.77
83_G	87_L	0.588	0.77
115_P	118_W	0.583	0.76
100_D	109_V	0.577	0.75
62_L	65_L	0.569	0.74
43_N	46_W	0.565	0.74
66_W	78_G	0.556	0.73
33_P	43_N	0.555	0.73
61_G	77_S	0.554	0.72
115_P	120_L	0.552	0.72
22_L	26_H	0.551	0.72
10_G	50_F	0.550	0.72
80_R	84_G	0.548	0.72
7_L	53_A	0.548	0.72
94_L	98_L	0.546	0.71
29_S	43_N	0.544	0.71
16_I	100_D	0.542	0.71
15_G	50_F	0.537	0.70
102_Q	120_L	0.532	0.69
121_G	126_G	0.531	0.69
17_V	28_L	0.530	0.69
31_G	46_W	0.529	0.69
74_V	80_R	0.525	0.68
75_A	80_R	0.520	0.68
15_G	96_E	0.519	0.68
127_A	134_W	0.518	0.67
34_P	46_W	0.518	0.67
68_A	72_G	0.517	0.67
51_H	95_V	0.517	0.67
33_P	36_T	0.513	0.67
10_G	54_T	0.512	0.66
50_F	95_V	0.512	0.66
58_T	70_R	0.510	0.66
33_P	37_V	0.508	0.66
23_Q	54_T	0.508	0.66
68_A	84_G	0.506	0.66
84_G	87_L	0.506	0.66
5_L	58_T	0.505	0.65
16_I	95_V	0.504	0.65
10_G	16_I	0.503	0.65
97_G	123_L	0.503	0.65
3_I	84_G	0.500	0.65

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2jo1A	1	0.2302	5.6	0.954	Contact Map
2jp3A	1	0.2374	3.4	0.958	Contact Map
2ks1B	1	0.3094	2.1	0.963	Contact Map
3mk7C	2	0.554	2	0.963	Contact Map
2zxeG	1	0.2302	2	0.963	Contact Map
3wu2C	1	0.964	1.9	0.963	Contact Map
2ipbA	2	0.259	1.8	0.964	Contact Map
3j1zP	8	0.8058	1.8	0.964	Contact Map
2mkvA	1	0.2878	1.7	0.964	Contact Map
4o6yA	2	0.9712	1.4	0.966	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0059 seconds.