DUF2213 - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

DUF2213 - Uncharacterized protein conserved in bacteria (DUF2213)

PFAM:	PF09979	Sequences: RRRTPEGYLVVKAVPIARTGVQEYLGSEIGELGLDPDKIVRVYRPPEEVFKPDSLASFEGKPVTDDHPPELVTADNWKELAVGTVGEDVRRDGDYLRADLVITDADAIDAIESGKRELSCGYTCDLDETPGTPDGEPYDAIQRNIRGNHVALVDRGRAGPDVRIGDS	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	167 (162)
Sequences:	3389 (2794)
Seq/√Len:	219.5
META:	0.881

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
125_D	144_N	3.676	1.00
3_R	112_E	3.234	1.00
58_F	147_G	3.149	1.00
23_E	41_R	2.730	1.00
105_A	109_D	2.573	1.00
16_I	98_A	2.503	1.00
127_D	143_R	2.447	1.00
65_D	110_A	2.333	1.00
158_A	162_V	2.326	1.00
55_L	96_L	2.277	1.00
23_E	39_I	2.200	1.00
85_V	150_V	2.071	1.00
78_K	104_D	2.055	1.00
45_P	141_I	2.052	1.00
75_D	105_A	1.963	1.00
82_V	107_A	1.911	1.00
43_Y	133_P	1.909	1.00
109_D	113_S	1.880	1.00
77_W	81_A	1.821	1.00
102_I	111_I	1.815	1.00
15_P	97_R	1.782	1.00
48_E	51_K	1.763	1.00
17_A	22_Q	1.747	1.00
117_E	156_G	1.646	1.00
120_C	147_G	1.630	1.00
128_E	140_A	1.597	1.00
42_V	140_A	1.587	1.00
69_P	80_L	1.574	1.00
132_T	136_E	1.570	1.00
26_G	40_V	1.556	1.00
52_P	56_A	1.548	1.00
15_P	95_Y	1.536	1.00
62_P	103_T	1.532	1.00
41_R	139_D	1.527	1.00
45_P	48_E	1.525	1.00
56_A	59_E	1.488	1.00
95_Y	161_D	1.476	1.00
21_V	41_R	1.472	1.00
65_D	107_A	1.463	1.00
65_D	115_K	1.454	1.00
6_E	61_K	1.450	1.00
120_C	158_A	1.433	1.00
35_D	38_K	1.424	1.00
84_T	103_T	1.414	1.00
81_A	103_T	1.400	1.00
85_V	98_A	1.399	1.00
78_K	82_V	1.388	1.00
156_G	162_V	1.376	1.00
48_E	143_R	1.374	1.00
66_D	115_K	1.365	1.00
26_G	30_G	1.348	1.00
92_D	97_R	1.304	1.00
72_V	77_W	1.300	1.00
22_Q	49_V	1.299	1.00
66_D	154_D	1.280	1.00
4_T	8_Y	1.275	1.00
41_R	136_E	1.250	1.00
10_V	101_V	1.246	1.00
44_R	49_V	1.237	1.00
127_D	141_I	1.225	1.00
50_F	91_R	1.215	1.00
110_A	115_K	1.197	1.00
86_G	89_V	1.196	1.00
63_V	102_I	1.188	1.00
107_A	152_L	1.187	1.00
64_T	68_P	1.186	1.00
58_F	120_C	1.186	1.00
54_S	57_S	1.176	1.00
51_K	144_N	1.167	1.00
82_V	104_D	1.137	1.00
120_C	150_V	1.120	1.00
117_E	160_P	1.105	1.00
88_D	99_D	1.103	1.00
115_K	154_D	1.090	1.00
84_T	101_V	1.087	1.00
130_P	139_D	1.065	1.00
61_K	85_V	1.060	1.00
63_V	100_L	1.056	1.00
132_T	135_G	1.052	1.00
57_S	147_G	1.040	1.00
51_K	146_R	1.038	1.00
127_D	130_P	1.030	1.00
129_T	141_I	1.024	1.00
46_P	91_R	1.021	1.00
72_V	80_L	1.019	1.00
60_G	87_E	1.002	1.00
59_E	89_V	1.000	1.00
54_S	145_I	0.999	1.00
54_S	147_G	0.996	1.00
48_E	141_I	0.991	1.00
131_G	138_Y	0.987	1.00
44_R	145_I	0.987	1.00
61_K	147_G	0.980	1.00
132_T	137_P	0.980	1.00
12_K	99_D	0.979	1.00
116_R	163_R	0.974	1.00
63_V	152_L	0.971	1.00
118_L	150_V	0.931	1.00
111_I	152_L	0.924	0.99
90_R	97_R	0.923	0.99
76_N	80_L	0.922	0.99
133_P	136_E	0.910	0.99
66_D	153_V	0.909	0.99
60_G	84_T	0.906	0.99
87_E	99_D	0.900	0.99
100_L	150_V	0.900	0.99
89_V	98_A	0.890	0.99
126_L	140_A	0.888	0.99
107_A	110_A	0.883	0.99
109_D	112_E	0.872	0.99
62_P	81_A	0.864	0.99
70_E	76_N	0.863	0.99
95_Y	162_V	0.859	0.99
71_L	123_T	0.857	0.99
13_A	118_L	0.854	0.99
40_V	140_A	0.845	0.99
73_T	76_N	0.843	0.99
26_G	36_P	0.834	0.99
64_T	72_V	0.823	0.99
25_L	39_I	0.818	0.99
41_R	137_P	0.816	0.99
74_A	108_I	0.815	0.99
8_Y	61_K	0.814	0.99
53_D	146_R	0.812	0.99
49_V	145_I	0.810	0.99
94_D	134_D	0.802	0.99
5_P	146_R	0.794	0.98
117_E	163_R	0.792	0.98
44_R	122_Y	0.791	0.98
15_P	162_V	0.774	0.98
48_E	145_I	0.774	0.98
42_V	126_L	0.769	0.98
16_I	120_C	0.765	0.98
60_G	86_G	0.761	0.98
106_D	110_A	0.759	0.98
59_E	88_D	0.757	0.98
51_K	54_S	0.757	0.98
8_Y	77_W	0.750	0.98
22_Q	44_R	0.750	0.98
16_I	147_G	0.747	0.98
18_R	161_D	0.740	0.98
59_E	98_A	0.738	0.97
104_D	107_A	0.735	0.97
19_T	46_P	0.733	0.97
70_E	80_L	0.729	0.97
77_W	103_T	0.721	0.97
54_S	58_F	0.718	0.97
100_L	118_L	0.718	0.97
8_Y	103_T	0.716	0.97
43_Y	132_T	0.715	0.97
29_I	40_V	0.708	0.97
27_S	37_D	0.707	0.97
13_A	97_R	0.701	0.97
4_T	10_V	0.696	0.96
58_F	96_L	0.694	0.96
124_C	142_Q	0.691	0.96
26_G	34_L	0.690	0.96
48_E	144_N	0.689	0.96
68_P	80_L	0.688	0.96
34_L	38_K	0.685	0.96
10_V	60_G	0.685	0.96
50_F	55_L	0.679	0.96
49_V	54_S	0.674	0.96
86_G	99_D	0.673	0.96
138_Y	141_I	0.671	0.96
17_A	49_V	0.670	0.96
44_R	142_Q	0.669	0.95
65_D	82_V	0.669	0.95
48_E	142_Q	0.669	0.95
26_G	29_I	0.667	0.95
125_D	143_R	0.658	0.95
70_E	73_T	0.654	0.95
13_A	16_I	0.652	0.95
42_V	124_C	0.652	0.95
29_I	42_V	0.651	0.95
91_R	94_D	0.650	0.95
25_L	29_I	0.647	0.95
21_V	43_Y	0.645	0.95
117_E	155_R	0.645	0.95
159_G	162_V	0.636	0.94
60_G	101_V	0.635	0.94
72_V	76_N	0.635	0.94
34_L	37_D	0.629	0.94
46_P	50_F	0.628	0.94
33_G	36_P	0.612	0.93
69_P	79_E	0.612	0.93
70_E	79_E	0.610	0.93
16_I	150_V	0.607	0.93
9_L	102_I	0.600	0.92
25_L	28_E	0.595	0.92
17_A	120_C	0.585	0.91
81_A	84_T	0.585	0.91
74_A	77_W	0.585	0.91
153_V	156_G	0.583	0.91
82_V	152_L	0.582	0.91
121_G	149_H	0.580	0.91
63_V	118_L	0.579	0.91
68_P	121_G	0.578	0.91
92_D	95_Y	0.574	0.90
44_R	166_D	0.572	0.90
47_E	50_F	0.572	0.90
86_G	90_R	0.572	0.90
85_V	118_L	0.571	0.90
17_A	44_R	0.571	0.90
21_V	139_D	0.569	0.90
8_Y	62_P	0.569	0.90
74_A	105_A	0.568	0.90
129_T	139_D	0.568	0.90
90_R	93_G	0.566	0.90
68_P	72_V	0.565	0.90
10_V	61_K	0.563	0.90
102_I	152_L	0.561	0.89
22_Q	120_C	0.559	0.89
111_I	164_I	0.556	0.89
19_T	45_P	0.554	0.89
3_R	9_L	0.550	0.88
59_E	87_E	0.546	0.88
16_I	85_V	0.546	0.88
130_P	137_P	0.538	0.87
26_G	35_D	0.537	0.87
110_A	113_S	0.535	0.87
17_A	96_L	0.533	0.87
18_R	117_E	0.524	0.86
87_E	91_R	0.521	0.86
22_Q	158_A	0.520	0.86
19_T	43_Y	0.520	0.86
11_V	100_L	0.520	0.86
63_V	150_V	0.516	0.85
106_D	109_D	0.516	0.85
96_L	147_G	0.515	0.85
156_G	163_R	0.514	0.85
30_G	40_V	0.513	0.85
43_Y	141_I	0.510	0.84
108_I	112_E	0.510	0.84
45_P	143_R	0.508	0.84
129_T	143_R	0.508	0.84
105_A	108_I	0.507	0.84
96_L	120_C	0.506	0.84
77_W	104_D	0.502	0.83
19_T	49_V	0.501	0.83
32_L	35_D	0.501	0.83
6_E	10_V	0.501	0.83
63_V	82_V	0.500	0.83

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
4v08A	2	0.7186	41.8	0.923	Contact Map
2pbkA	2	0.7246	21.2	0.933	Contact Map
4p3hA	4	0.7186	20.6	0.934	Contact Map
1at3A	3	0.7365	19.7	0.935	Contact Map
1vzvA	2	0.7066	19.2	0.935	Contact Map
1iedA	2	0.7126	16.3	0.937	Contact Map
1o6eA	4	0.7665	15.5	0.937	Contact Map
4wsbC	1	0.7246	12	0.941	Contact Map
4ct3A	4	0.6467	4.6	0.951	Contact Map
1tnsA	1	0.4311	2.9	0.956	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0068 seconds.