DUF2199 - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

DUF2199 - Uncharacterized protein conserved in bacteria (DUF2199)

PFAM:	PF09965	Sequences: KCSCCGEEHEGLPDFGFDAPDYYLALPEEEREERAELTSDLCVIDGEHFFVRGVLEIPVIGSDEPFGWGVWVSLSEENFERYLELWDDPGREHEPPYFGWLSNRLPGYPDTLNLKTRVHLRPVGQRPLIELEPTDHPLAVEQRNGI	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	146 (146)
Sequences:	2906 (2424)
Seq/√Len:	200.6
META:	0.897

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
104_R	110_D	3.312	1.00
34_R	45_D	2.790	1.00
4_C	9_H	2.694	1.00
76_E	80_E	2.625	1.00
53_G	129_I	2.421	1.00
22_Y	102_S	2.371	1.00
121_R	128_L	2.290	1.00
116_T	129_I	2.131	1.00
82_Y	86_W	2.116	1.00
14_D	67_G	2.097	1.00
108_Y	141_E	2.075	1.00
85_L	94_E	2.057	1.00
23_Y	35_A	2.035	1.00
38_T	41_L	1.931	1.00
56_E	65_P	1.891	1.00
81_R	94_E	1.866	1.00
119_H	130_E	1.844	1.00
48_H	73_S	1.767	1.00
17_F	103_N	1.762	1.00
56_E	67_G	1.760	1.00
140_V	144_N	1.740	1.00
52_R	69_G	1.713	1.00
81_R	85_L	1.706	1.00
41_L	83_L	1.705	1.00
72_V	99_G	1.666	1.00
1_K	8_E	1.661	1.00
72_V	129_I	1.642	1.00
111_T	114_L	1.609	1.00
54_V	69_G	1.571	1.00
117_R	130_E	1.514	1.00
54_V	67_G	1.512	1.00
26_L	35_A	1.512	1.00
1_K	6_G	1.496	1.00
75_S	78_N	1.488	1.00
101_L	116_T	1.471	1.00
56_E	121_R	1.427	1.00
99_G	118_V	1.419	1.00
92_E	122_P	1.412	1.00
117_R	132_E	1.388	1.00
55_L	70_V	1.374	1.00
80_E	84_E	1.371	1.00
115_K	132_E	1.369	1.00
134_T	139_A	1.352	1.00
102_S	113_N	1.352	1.00
72_V	116_T	1.350	1.00
21_D	103_N	1.349	1.00
97_Y	120_L	1.316	1.00
30_E	34_R	1.305	1.00
132_E	139_A	1.294	1.00
19_A	23_Y	1.290	1.00
51_V	82_Y	1.289	1.00
40_D	126_R	1.270	1.00
19_A	37_L	1.261	1.00
114_L	136_H	1.246	1.00
81_R	95_P	1.208	1.00
100_W	115_K	1.164	1.00
85_L	88_D	1.161	1.00
78_N	98_F	1.147	1.00
41_L	82_Y	1.138	1.00
26_L	31_R	1.136	1.00
139_A	143_R	1.133	1.00
72_V	118_V	1.123	1.00
81_R	84_E	1.122	1.00
99_G	116_T	1.112	1.00
17_F	105_L	1.111	1.00
23_Y	26_L	1.094	1.00
26_L	34_R	1.093	1.00
70_V	129_I	1.092	1.00
56_E	128_L	1.067	1.00
62_S	65_P	1.044	1.00
137_P	140_V	1.037	1.00
57_I	138_L	1.030	1.00
59_V	65_P	1.020	1.00
43_V	79_F	1.014	1.00
55_L	101_L	1.014	1.00
69_G	126_R	1.006	1.00
70_V	101_L	1.004	1.00
135_D	140_V	1.000	1.00
21_D	25_A	0.994	1.00
22_Y	48_H	0.988	1.00
22_Y	112_L	0.988	1.00
78_N	100_W	0.981	1.00
2_C	5_C	0.973	0.99
74_L	118_V	0.967	0.99
109_P	137_P	0.962	0.99
51_V	74_L	0.956	0.99
73_S	100_W	0.946	0.99
21_D	112_L	0.935	0.99
21_D	24_L	0.934	0.99
14_D	69_G	0.913	0.99
98_F	117_R	0.906	0.99
131_L	142_Q	0.905	0.99
73_S	78_N	0.901	0.99
73_S	98_F	0.895	0.99
90_G	122_P	0.892	0.99
94_E	97_Y	0.889	0.99
8_E	11_G	0.882	0.99
57_I	68_W	0.882	0.99
133_P	139_A	0.872	0.99
37_L	42_C	0.863	0.99
68_W	141_E	0.860	0.99
47_E	76_E	0.860	0.99
96_P	117_R	0.855	0.99
44_I	48_H	0.854	0.99
54_V	126_R	0.853	0.99
36_E	43_V	0.840	0.99
105_L	111_T	0.838	0.98
43_V	49_F	0.836	0.98
27_P	30_E	0.827	0.98
137_P	141_E	0.819	0.98
74_L	120_L	0.818	0.98
41_L	86_W	0.816	0.98
74_L	97_Y	0.816	0.98
121_R	125_Q	0.815	0.98
15_F	68_W	0.814	0.98
19_A	24_L	0.813	0.98
140_V	143_R	0.807	0.98
98_F	116_T	0.807	0.98
49_F	76_E	0.804	0.98
45_D	49_F	0.802	0.98
78_N	97_Y	0.780	0.98
22_Y	113_N	0.773	0.97
91_R	123_V	0.773	0.97
86_W	123_V	0.773	0.97
17_F	69_G	0.767	0.97
100_W	113_N	0.766	0.97
35_A	44_I	0.761	0.97
23_Y	37_L	0.761	0.97
49_F	79_F	0.759	0.97
9_H	12_L	0.758	0.97
89_P	123_V	0.747	0.97
16_G	52_R	0.744	0.97
98_F	115_K	0.743	0.97
120_L	123_V	0.743	0.97
18_D	24_L	0.741	0.97
114_L	131_L	0.739	0.97
90_G	93_H	0.738	0.97
1_K	4_C	0.731	0.96
78_N	118_V	0.730	0.96
88_D	92_E	0.730	0.96
70_V	105_L	0.730	0.96
122_P	125_Q	0.719	0.96
82_Y	120_L	0.716	0.96
80_E	83_L	0.716	0.96
134_T	140_V	0.712	0.96
23_Y	44_I	0.709	0.96
7_E	11_G	0.707	0.96
29_E	32_E	0.704	0.96
141_E	146_I	0.701	0.96
68_W	108_Y	0.698	0.95
28_E	31_R	0.697	0.95
11_G	14_D	0.690	0.95
50_F	103_N	0.687	0.95
41_L	79_F	0.684	0.95
91_R	122_P	0.673	0.94
50_F	102_S	0.669	0.94
51_V	118_V	0.669	0.94
48_H	102_S	0.662	0.94
95_P	120_L	0.660	0.94
26_L	44_I	0.660	0.94
61_G	65_P	0.653	0.93
91_R	124_G	0.650	0.93
138_L	142_Q	0.647	0.93
24_L	27_P	0.638	0.93
68_W	107_G	0.637	0.93
50_F	73_S	0.629	0.92
96_P	130_E	0.625	0.92
38_T	83_L	0.618	0.91
31_R	35_A	0.616	0.91
75_S	100_W	0.609	0.91
70_V	103_N	0.608	0.91
16_G	69_G	0.605	0.91
84_E	87_D	0.599	0.90
53_G	72_V	0.597	0.90
118_V	129_I	0.594	0.90
111_T	136_H	0.594	0.90
14_D	54_V	0.590	0.90
86_W	89_P	0.590	0.90
60_I	65_P	0.590	0.90
92_E	123_V	0.589	0.89
22_Y	50_F	0.589	0.89
96_P	119_H	0.589	0.89
39_S	86_W	0.588	0.89
77_E	80_E	0.588	0.89
49_F	80_E	0.588	0.89
24_L	31_R	0.585	0.89
35_A	45_D	0.585	0.89
3_S	8_E	0.584	0.89
53_G	67_G	0.583	0.89
85_L	95_P	0.575	0.88
131_L	138_L	0.573	0.88
131_L	139_A	0.566	0.88
34_R	44_I	0.565	0.87
34_R	46_G	0.565	0.87
23_Y	31_R	0.564	0.87
21_D	104_R	0.561	0.87
24_L	34_R	0.558	0.87
132_E	140_V	0.555	0.87
39_S	126_R	0.555	0.87
125_Q	128_L	0.553	0.86
64_E	67_G	0.552	0.86
133_P	143_R	0.551	0.86
36_E	83_L	0.549	0.86
115_K	139_A	0.546	0.86
27_P	31_R	0.544	0.85
28_E	32_E	0.539	0.85
115_K	134_T	0.538	0.85
26_L	45_D	0.536	0.85
54_V	121_R	0.532	0.84
66_F	142_Q	0.525	0.83
90_G	123_V	0.525	0.83
26_L	29_E	0.520	0.83
46_G	76_E	0.515	0.82
14_D	65_P	0.515	0.82
3_S	7_E	0.508	0.81
44_I	73_S	0.506	0.81
73_S	116_T	0.505	0.81
132_E	143_R	0.501	0.80
91_R	120_L	0.500	0.80

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
1gh9A	1	0.2945	11.2	0.934	Contact Map
2k5cA	1	0.2877	10	0.935	Contact Map
2f9yB	1	0.8151	9.9	0.935	Contact Map
1twfL	1	0.1644	9.1	0.936	Contact Map
2ej4A	1	0.2192	8	0.938	Contact Map
3py7A	1	0.2877	7.6	0.938	Contact Map
2pk7A	2	0.2671	7.5	0.939	Contact Map
2lvhA	1	0.0822	6.7	0.94	Contact Map
2m4yA	1	0.1301	6.5	0.94	Contact Map
2jnyA	1	0.2192	6.3	0.941	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0062 seconds.