DUF2190 - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

DUF2190 - Uncharacterized conserved protein (DUF2190)

PFAM:	PF09956	Sequences: MKNYVQPGDTITYTAPAAVASGDVVVVGSLVGVALTDAAAGETGAVAVEGVFELPKAAAAAIAVGDKVYWDATAKVVTTTATGNTLIGVAVEAAAAGDTTVRVRL	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	105 (102)
Sequences:	6043 (5134)
Seq/√Len:	508.3
META:	0.909

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
38_A	44_G	2.814	1.00
67_K	86_L	2.539	1.00
53_E	102_R	2.525	1.00
32_G	46_V	2.320	1.00
35_L	47_A	2.248	1.00
18_A	39_A	2.248	1.00
47_A	52_F	2.155	1.00
62_I	90_A	2.113	1.00
68_V	90_A	2.090	1.00
62_I	101_V	2.063	1.00
92_E	102_R	2.048	1.00
20_A	23_D	1.993	1.00
12_T	45_A	1.935	1.00
56_K	94_A	1.908	1.00
18_A	40_A	1.806	1.00
66_D	79_T	1.778	1.00
77_V	87_I	1.729	1.00
10_T	45_A	1.622	1.00
9_D	49_E	1.615	1.00
53_E	100_T	1.603	1.00
25_V	46_V	1.595	1.00
71_D	74_A	1.594	1.00
57_A	60_A	1.589	1.00
19_V	34_A	1.548	1.00
12_T	43_T	1.521	1.00
63_A	66_D	1.517	1.00
36_T	45_A	1.489	1.00
20_A	37_D	1.487	1.00
62_I	68_V	1.456	1.00
57_A	76_V	1.407	1.00
24_V	31_V	1.385	1.00
48_V	104_R	1.359	1.00
39_A	42_E	1.357	1.00
31_V	87_I	1.331	1.00
86_L	89_V	1.259	1.00
95_A	98_D	1.230	1.00
13_Y	46_V	1.215	1.00
10_T	35_L	1.215	1.00
15_A	38_A	1.184	1.00
29_S	67_K	1.165	1.00
94_A	98_D	1.141	1.00
23_D	34_A	1.117	1.00
17_A	40_A	1.086	1.00
69_Y	86_L	1.074	1.00
91_V	102_R	1.046	1.00
13_Y	19_V	1.040	1.00
10_T	47_A	1.018	1.00
32_G	48_V	1.015	1.00
35_L	52_F	1.012	1.00
54_L	77_V	1.001	1.00
63_A	93_A	0.990	1.00
5_V	102_R	0.988	1.00
5_V	53_E	0.977	1.00
49_E	104_R	0.976	1.00
21_S	37_D	0.972	1.00
72_A	75_K	0.969	1.00
64_V	93_A	0.954	1.00
60_A	79_T	0.953	1.00
26_V	31_V	0.948	1.00
15_A	19_V	0.944	1.00
54_L	87_I	0.941	1.00
49_E	52_F	0.938	1.00
15_A	44_G	0.924	1.00
67_K	89_V	0.924	1.00
6_Q	51_V	0.922	1.00
14_T	43_T	0.918	1.00
68_V	77_V	0.915	1.00
26_V	85_T	0.880	1.00
11_I	91_V	0.873	1.00
51_V	91_V	0.873	1.00
14_T	64_V	0.870	1.00
38_A	42_E	0.869	1.00
24_V	87_I	0.867	1.00
24_V	70_W	0.848	1.00
25_V	34_A	0.845	1.00
25_V	32_G	0.841	1.00
8_G	51_V	0.828	1.00
16_P	40_A	0.821	1.00
68_V	103_V	0.791	1.00
19_V	23_D	0.785	1.00
33_V	54_L	0.785	1.00
29_S	85_T	0.783	1.00
80_T	84_N	0.782	1.00
30_L	89_V	0.780	1.00
64_V	92_E	0.777	1.00
61_A	96_A	0.758	1.00
34_A	38_A	0.750	1.00
58_A	97_G	0.747	1.00
56_K	62_I	0.741	1.00
90_A	101_V	0.741	1.00
66_D	90_A	0.732	1.00
78_T	81_A	0.726	1.00
66_D	93_A	0.722	1.00
80_T	83_G	0.717	1.00
4_Y	7_P	0.717	1.00
82_T	85_T	0.701	1.00
4_Y	50_G	0.697	1.00
70_W	75_K	0.691	1.00
34_A	44_G	0.691	1.00
9_D	47_A	0.688	1.00
4_Y	47_A	0.687	1.00
51_V	102_R	0.685	1.00
19_V	38_A	0.685	1.00
19_V	44_G	0.683	1.00
59_A	96_A	0.679	1.00
70_W	74_A	0.677	1.00
21_S	36_T	0.667	1.00
13_Y	27_V	0.665	1.00
68_V	88_G	0.664	1.00
71_D	75_K	0.659	1.00
29_S	66_D	0.655	1.00
69_Y	80_T	0.654	1.00
15_A	18_A	0.653	1.00
24_V	33_V	0.651	1.00
64_V	91_V	0.644	1.00
60_A	78_T	0.642	1.00
95_A	99_T	0.640	1.00
62_I	79_T	0.628	1.00
18_A	37_D	0.625	1.00
62_I	66_D	0.623	1.00
69_Y	84_N	0.622	1.00
6_Q	91_V	0.619	1.00
89_V	104_R	0.618	1.00
94_A	97_G	0.615	1.00
78_T	84_N	0.595	0.99
26_V	72_A	0.594	0.99
38_A	46_V	0.581	0.99
23_D	37_D	0.580	0.99
62_I	77_V	0.578	0.99
81_A	84_N	0.575	0.99
92_E	98_D	0.571	0.99
74_A	78_T	0.568	0.99
58_A	94_A	0.563	0.99
27_V	64_V	0.562	0.99
24_V	34_A	0.560	0.99
61_A	93_A	0.560	0.99
69_Y	78_T	0.558	0.99
54_L	103_V	0.551	0.99
7_P	10_T	0.548	0.99
55_P	76_V	0.545	0.99
27_V	30_L	0.544	0.99
31_V	70_W	0.540	0.99
13_Y	48_V	0.540	0.99
15_A	40_A	0.537	0.99
19_V	25_V	0.536	0.99
17_A	75_K	0.523	0.99
13_Y	64_V	0.519	0.98
13_Y	38_A	0.517	0.98
87_I	103_V	0.515	0.98
39_A	44_G	0.514	0.98
33_V	52_F	0.510	0.98
63_A	79_T	0.504	0.98
81_A	85_T	0.500	0.98

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3teeA	1	0.6952	17.4	0.87	Contact Map
3frnA	1	0.8	16.5	0.871	Contact Map
3lazA	2	0.5048	11.8	0.88	Contact Map
3k3sA	2	0.4857	8.8	0.886	Contact Map
3v77A	5	0.5619	8.6	0.887	Contact Map
3s52A	2	0.5333	7.1	0.891	Contact Map
1gttA	1	0.6	7.1	0.891	Contact Map
4dbfA	2	0.5619	6.9	0.891	Contact Map
2eb4A	5	0.5429	6.2	0.894	Contact Map
4p5nA	2	0.4667	6	0.894	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0052 seconds.