AbiEi_2 - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

AbiEi_2 - Transcriptional regulator, AbiEi antitoxin, Type IV TA system

PFAM:	PF09952	Sequences: RLTNPEELLDRWVEAYPERLRPKLLLGRFRADDPDWWKEADLAEAGAAWGGESAAALLTPYLRPETVTIYVATEEDLEELAKALRLRPDPSGNVELLEPFWGFEEEIDGLDVVPPLLVYADLLATGDGRGIEAAEHIYEEYLQ	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	143 (139)
Sequences:	4160 (3323)
Seq/√Len:	281.8
META:	0.924

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
4_N	7_E	4.429	1.00
113_V	118_V	3.319	1.00
48_A	113_V	2.979	1.00
54_A	118_V	2.941	1.00
6_E	10_D	2.686	1.00
86_L	94_V	2.637	1.00
125_T	130_G	2.310	1.00
58_L	115_P	2.299	1.00
135_E	139_E	2.243	1.00
10_D	138_Y	2.236	1.00
9_L	116_L	2.208	1.00
58_L	118_V	2.129	1.00
30_R	89_D	2.112	1.00
30_R	93_N	2.087	1.00
53_S	67_V	1.975	1.00
48_A	99_P	1.938	1.00
21_R	97_L	1.921	1.00
61_Y	133_A	1.917	1.00
6_E	138_Y	1.869	1.00
11_R	14_E	1.839	1.00
123_L	131_I	1.814	1.00
56_A	64_P	1.810	1.00
11_R	18_E	1.723	1.00
70_Y	121_D	1.658	1.00
136_H	140_E	1.635	1.00
52_E	62_L	1.581	1.00
35_D	38_K	1.581	1.00
61_Y	136_H	1.572	1.00
131_I	135_E	1.503	1.00
89_D	93_N	1.492	1.00
49_W	53_S	1.468	1.00
56_A	60_P	1.447	1.00
51_G	68_T	1.446	1.00
13_V	123_L	1.431	1.00
37_W	40_A	1.400	1.00
11_R	15_A	1.377	1.00
74_E	98_E	1.370	1.00
36_W	40_A	1.353	1.00
33_D	37_W	1.338	1.00
77_L	81_A	1.281	1.00
79_E	83_A	1.268	1.00
50_G	113_V	1.227	1.00
55_A	118_V	1.224	1.00
5_P	9_L	1.221	1.00
58_L	112_V	1.218	1.00
53_S	57_L	1.171	1.00
66_T	95_E	1.164	1.00
129_R	132_E	1.161	1.00
24_L	88_P	1.123	1.00
54_A	113_V	1.121	1.00
79_E	82_K	1.092	1.00
113_V	117_L	1.087	1.00
52_E	64_P	1.081	1.00
28_R	92_G	1.078	1.00
133_A	136_H	1.075	1.00
27_G	30_R	1.071	1.00
13_V	120_A	1.070	1.00
73_T	76_D	1.070	1.00
137_I	141_Y	1.068	1.00
81_A	86_L	1.062	1.00
101_W	114_P	1.056	1.00
10_D	14_E	1.049	1.00
7_E	10_D	1.048	1.00
17_P	124_A	1.041	1.00
78_E	81_A	1.036	1.00
25_L	28_R	1.032	1.00
54_A	112_V	1.027	1.00
45_A	83_A	1.021	1.00
13_V	119_Y	1.011	1.00
35_D	39_E	1.004	1.00
106_E	109_G	0.990	1.00
40_A	45_A	0.985	1.00
27_G	31_A	0.985	1.00
57_L	111_D	0.981	1.00
15_A	18_E	0.966	1.00
43_A	46_G	0.950	1.00
59_T	133_A	0.943	1.00
41_D	44_E	0.940	1.00
115_P	141_Y	0.937	1.00
71_V	96_L	0.937	1.00
16_Y	21_R	0.924	1.00
32_D	36_W	0.918	1.00
128_G	133_A	0.914	1.00
102_G	105_E	0.912	1.00
113_V	121_D	0.908	1.00
76_D	79_E	0.903	1.00
41_D	45_A	0.897	1.00
39_E	46_G	0.890	1.00
68_T	97_L	0.890	1.00
26_L	98_E	0.888	1.00
14_E	18_E	0.882	1.00
28_R	95_E	0.874	1.00
52_E	130_G	0.870	1.00
23_K	95_E	0.869	1.00
100_F	104_E	0.865	1.00
32_D	37_W	0.863	1.00
68_T	95_E	0.860	1.00
70_Y	99_P	0.850	1.00
61_Y	132_E	0.846	1.00
54_A	64_P	0.839	1.00
37_W	41_D	0.838	1.00
112_V	118_V	0.823	1.00
59_T	136_H	0.819	1.00
42_L	45_A	0.815	0.99
54_A	57_L	0.814	0.99
117_L	120_A	0.810	0.99
36_W	39_E	0.804	0.99
42_L	47_A	0.803	0.99
55_A	58_L	0.797	0.99
43_A	47_A	0.788	0.99
119_Y	123_L	0.784	0.99
5_P	116_L	0.780	0.99
39_E	43_A	0.778	0.99
26_L	29_F	0.776	0.99
49_W	67_V	0.775	0.99
99_P	117_L	0.773	0.99
18_E	21_R	0.769	0.99
55_A	137_I	0.767	0.99
80_L	84_L	0.754	0.99
105_E	109_G	0.753	0.99
106_E	111_D	0.751	0.99
55_A	133_A	0.749	0.99
69_I	96_L	0.736	0.99
25_L	98_E	0.733	0.99
37_W	42_L	0.731	0.99
33_D	39_E	0.725	0.99
82_K	88_P	0.725	0.99
64_P	67_V	0.712	0.99
138_Y	141_Y	0.711	0.99
52_E	68_T	0.710	0.99
101_W	104_E	0.709	0.99
39_E	45_A	0.709	0.99
89_D	92_G	0.704	0.98
13_V	116_L	0.695	0.98
10_D	13_V	0.690	0.98
25_L	95_E	0.689	0.98
34_P	38_K	0.685	0.98
125_T	128_G	0.685	0.98
38_K	46_G	0.682	0.98
100_F	105_E	0.681	0.98
115_P	137_I	0.677	0.98
49_W	69_I	0.675	0.98
126_G	131_I	0.673	0.98
44_E	83_A	0.662	0.98
70_Y	119_Y	0.660	0.98
19_R	23_K	0.658	0.98
135_E	138_Y	0.658	0.98
62_L	130_G	0.657	0.98
7_E	11_R	0.654	0.98
68_T	125_T	0.652	0.98
25_L	97_L	0.651	0.98
78_E	82_K	0.633	0.97
100_F	103_F	0.626	0.97
116_L	120_A	0.624	0.97
131_I	138_Y	0.624	0.97
127_D	130_G	0.622	0.97
115_P	118_V	0.621	0.97
130_G	133_A	0.621	0.97
42_L	49_W	0.621	0.97
102_G	114_P	0.620	0.97
42_L	46_G	0.616	0.97
32_D	35_D	0.612	0.96
39_E	42_L	0.612	0.96
32_D	85_R	0.610	0.96
11_R	27_G	0.607	0.96
20_L	24_L	0.603	0.96
54_A	58_L	0.602	0.96
62_L	136_H	0.596	0.96
50_G	118_V	0.592	0.96
24_L	98_E	0.590	0.96
34_P	37_W	0.588	0.95
52_E	65_E	0.588	0.95
86_L	96_L	0.582	0.95
82_K	87_R	0.573	0.95
70_Y	113_V	0.570	0.95
25_L	29_F	0.568	0.95
26_L	30_R	0.566	0.94
49_W	112_V	0.565	0.94
41_D	111_D	0.561	0.94
17_P	21_R	0.554	0.94
40_A	44_E	0.550	0.94
53_S	64_P	0.550	0.94
114_P	118_V	0.548	0.93
55_A	122_L	0.548	0.93
116_L	141_Y	0.547	0.93
49_W	130_G	0.547	0.93
21_R	29_F	0.544	0.93
73_T	79_E	0.542	0.93
49_W	111_D	0.539	0.93
123_L	135_E	0.536	0.93
36_W	42_L	0.531	0.92
38_K	41_D	0.530	0.92
34_P	39_E	0.529	0.92
2_L	5_P	0.525	0.92
41_D	83_A	0.523	0.92
77_L	98_E	0.520	0.92
34_P	47_A	0.519	0.92
48_A	54_A	0.516	0.91
119_Y	134_A	0.516	0.91
42_L	69_I	0.513	0.91
36_W	44_E	0.511	0.91
36_W	43_A	0.509	0.91
99_P	103_F	0.508	0.91
26_L	81_A	0.507	0.91
61_Y	116_L	0.507	0.91
81_A	84_L	0.503	0.90
129_R	133_A	0.501	0.90
38_K	42_L	0.500	0.90

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
1zelA	1	0.9371	33.8	0.903	Contact Map
3ismC	1	0.2797	5.1	0.934	Contact Map
4gvpA	1	0.5175	3.6	0.939	Contact Map
4nbiA	2	0.7063	3	0.941	Contact Map
1a04A	1	0.5315	2.9	0.941	Contact Map
3c3wA	2	0.5175	2.8	0.942	Contact Map
3eulA	2	0.5315	2.8	0.942	Contact Map
2dulA	2	0.4056	2.7	0.942	Contact Map
2jnuA	1	0.4755	2.7	0.942	Contact Map
2qv0A	2	0.5105	2.6	0.942	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0062 seconds.