DUF2182 - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

DUF2182 - Predicted metal-binding integral membrane protein (DUF2182)

PFAM:	PF09948	Sequences: FAMWVVMMAAMMLPSAAPMVLLYARVARRRGRRRAATALFVAGYLLVWTAFGLAAYALQWALHRAALLSPAMARASPLLAGAVLLAAGLYQLTPLKDACLRHCRSPLGFLLRHWRDGARGALRMGLRHGLYCVGCCWALMALLFVLGVMNLAWMAALAALVLAEKLLPWGRRVARAAGVALIALGVLM	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	188 (186)
Sequences:	15123 (10053)
Seq/√Len:	737.1
META:	0.954

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
85_L	185_G	3.606	1.00
47_V	133_V	3.489	1.00
160_L	177_A	3.352	1.00
113_H	127_R	3.321	1.00
123_R	127_R	3.218	1.00
5_V	49_T	2.936	1.00
99_C	134_G	2.716	1.00
91_Q	164_E	2.710	1.00
46_L	122_L	2.672	1.00
170_G	174_A	2.409	1.00
163_A	167_L	2.243	1.00
81_G	185_G	2.203	1.00
171_R	175_R	2.198	1.00
39_L	118_A	2.179	1.00
172_R	175_R	2.175	1.00
20_V	41_V	2.097	1.00
162_L	166_L	2.093	1.00
51_F	133_V	2.038	1.00
16_A	20_V	1.961	1.00
88_G	182_I	1.935	1.00
119_R	123_R	1.931	1.00
23_Y	27_A	1.910	1.00
99_C	131_Y	1.901	1.00
25_R	29_R	1.882	1.00
169_W	172_R	1.880	1.00
19_M	40_F	1.859	1.00
74_R	79_L	1.823	1.00
143_L	154_M	1.773	1.00
78_L	82_A	1.761	1.00
43_G	129_G	1.725	1.00
24_A	37_T	1.660	1.00
107_L	111_L	1.646	1.00
60_W	64_R	1.635	1.00
61_A	65_A	1.623	1.00
142_L	146_L	1.604	1.00
172_R	176_A	1.573	1.00
59_Q	63_H	1.536	1.00
52_G	56_Y	1.486	1.00
88_G	178_G	1.485	1.00
163_A	173_V	1.473	1.00
15_S	165_K	1.464	1.00
51_F	55_A	1.438	1.00
143_L	157_L	1.438	1.00
97_D	101_R	1.436	1.00
31_G	34_R	1.404	1.00
91_Q	96_K	1.387	1.00
158_A	162_L	1.333	1.00
21_L	25_R	1.324	1.00
97_D	171_R	1.304	1.00
39_L	121_A	1.304	1.00
109_F	127_R	1.287	1.00
152_A	155_A	1.286	1.00
146_L	153_W	1.285	1.00
17_A	21_L	1.243	1.00
148_V	154_M	1.230	1.00
61_A	64_R	1.224	1.00
102_H	131_Y	1.224	1.00
31_G	35_A	1.219	1.00
169_W	173_V	1.217	1.00
43_G	122_L	1.213	1.00
39_L	122_L	1.197	1.00
9_A	13_L	1.195	1.00
79_L	82_A	1.195	1.00
174_A	177_A	1.191	1.00
92_L	178_G	1.190	1.00
71_A	75_A	1.183	1.00
69_S	73_A	1.183	1.00
171_R	174_A	1.163	1.00
27_A	36_A	1.158	1.00
174_A	178_G	1.144	1.00
75_A	78_L	1.140	1.00
114_W	124_M	1.136	1.00
82_A	86_A	1.129	1.00
19_M	22_L	1.129	1.00
89_L	94_P	1.125	1.00
125_G	129_G	1.125	1.00
108_G	112_R	1.111	1.00
81_G	85_L	1.093	1.00
151_L	154_M	1.086	1.00
120_G	124_M	1.083	1.00
117_G	120_G	1.073	1.00
20_V	40_F	1.069	1.00
108_G	111_L	1.067	1.00
83_V	145_V	1.057	1.00
5_V	9_A	1.049	1.00
25_R	28_R	1.041	1.00
173_V	176_A	1.040	1.00
13_L	41_V	1.032	1.00
72_M	75_A	1.032	1.00
182_I	186_V	1.023	1.00
96_K	164_E	1.020	1.00
47_V	126_L	1.009	1.00
17_A	24_A	1.004	1.00
27_A	30_R	1.002	1.00
30_R	116_D	0.997	1.00
105_S	108_G	0.997	1.00
154_M	161_V	0.996	1.00
60_W	63_H	0.993	1.00
56_Y	59_Q	0.993	1.00
96_K	100_L	0.983	1.00
64_R	68_L	0.982	1.00
46_L	50_A	0.976	1.00
139_L	181_L	0.974	1.00
115_R	120_G	0.965	1.00
97_D	175_R	0.964	1.00
57_A	61_A	0.963	1.00
20_V	37_T	0.957	1.00
183_A	187_L	0.954	1.00
152_A	156_A	0.941	1.00
170_G	173_V	0.940	1.00
115_R	123_R	0.938	1.00
179_V	183_A	0.934	1.00
50_A	54_A	0.933	1.00
110_L	113_H	0.918	1.00
23_Y	37_T	0.904	1.00
98_A	101_R	0.901	1.00
90_Y	138_A	0.898	1.00
63_H	68_L	0.896	1.00
43_G	125_G	0.895	1.00
72_M	76_S	0.894	1.00
157_L	161_V	0.890	1.00
98_A	102_H	0.885	1.00
42_A	46_L	0.882	1.00
23_Y	36_A	0.877	1.00
126_L	130_L	0.876	1.00
102_H	112_R	0.868	1.00
68_L	74_R	0.862	1.00
146_L	157_L	0.859	1.00
13_L	45_L	0.857	1.00
94_P	98_A	0.850	1.00
111_L	114_W	0.847	1.00
160_L	181_L	0.847	1.00
56_Y	60_W	0.839	1.00
106_P	109_F	0.831	1.00
24_A	27_A	0.831	1.00
83_V	141_A	0.824	1.00
175_R	179_V	0.823	1.00
69_S	72_M	0.821	1.00
80_A	145_V	0.820	1.00
106_P	110_L	0.808	1.00
93_T	96_K	0.804	1.00
19_M	26_V	0.802	1.00
104_R	108_G	0.799	1.00
83_V	142_L	0.795	1.00
68_L	72_M	0.784	1.00
74_R	80_A	0.780	1.00
85_L	182_I	0.779	1.00
142_L	145_V	0.779	1.00
109_F	113_H	0.778	1.00
110_L	114_W	0.775	1.00
15_S	161_V	0.768	1.00
137_W	140_M	0.766	1.00
54_A	57_A	0.765	1.00
78_L	81_G	0.765	1.00
46_L	126_L	0.763	1.00
22_L	26_V	0.761	1.00
177_A	180_A	0.754	1.00
57_A	60_W	0.752	1.00
84_L	142_L	0.752	1.00
69_S	75_A	0.745	1.00
66_A	70_P	0.744	1.00
63_H	66_A	0.742	1.00
104_R	171_R	0.739	1.00
176_A	180_A	0.735	1.00
143_L	161_V	0.731	1.00
177_A	181_L	0.727	1.00
100_L	104_R	0.726	1.00
59_Q	62_L	0.721	1.00
176_A	179_V	0.719	1.00
59_Q	68_L	0.714	1.00
55_A	144_F	0.712	1.00
146_L	156_A	0.709	1.00
20_V	24_A	0.708	1.00
84_L	184_L	0.706	1.00
147_G	150_N	0.706	1.00
180_A	184_L	0.706	1.00
16_A	19_M	0.697	1.00
173_V	177_A	0.697	1.00
112_R	116_D	0.690	1.00
74_R	77_P	0.688	1.00
138_A	142_L	0.685	1.00
40_F	128_H	0.685	1.00
118_A	121_A	0.683	1.00
181_L	184_L	0.680	1.00
161_V	165_K	0.678	1.00
89_L	93_T	0.675	1.00
52_G	59_Q	0.669	1.00
36_A	118_A	0.669	1.00
150_N	154_M	0.667	1.00
44_Y	128_H	0.666	1.00
36_A	39_L	0.665	1.00
2_A	6_V	0.664	1.00
104_R	170_G	0.661	1.00
114_W	117_G	0.660	1.00
117_G	121_A	0.659	1.00
70_P	74_R	0.658	1.00
121_A	125_G	0.658	1.00
35_A	118_A	0.654	1.00
3_M	6_V	0.651	1.00
87_A	142_L	0.646	1.00
88_G	185_G	0.641	1.00
64_R	67_L	0.638	1.00
109_F	128_H	0.638	1.00
100_L	164_E	0.636	1.00
86_A	138_A	0.636	1.00
24_A	29_R	0.633	1.00
47_V	50_A	0.629	1.00
134_G	140_M	0.627	1.00
88_G	92_L	0.622	1.00
110_L	120_G	0.622	1.00
149_M	153_W	0.621	1.00
138_A	141_A	0.616	1.00
3_M	8_M	0.616	1.00
26_V	114_W	0.613	1.00
169_W	176_A	0.612	1.00
22_L	110_L	0.605	1.00
38_A	41_V	0.603	1.00
22_L	25_R	0.603	1.00
32_R	35_A	0.603	1.00
113_H	123_R	0.601	1.00
90_Y	95_L	0.599	1.00
115_R	124_M	0.599	1.00
9_A	45_L	0.597	1.00
155_A	162_L	0.590	1.00
23_Y	30_R	0.590	1.00
170_G	175_R	0.586	1.00
8_M	149_M	0.586	1.00
182_I	185_G	0.584	1.00
109_F	114_W	0.582	1.00
163_A	166_L	0.581	1.00
92_L	175_R	0.581	1.00
113_H	116_D	0.580	1.00
62_L	65_A	0.580	1.00
3_M	7_M	0.577	1.00
86_A	89_L	0.574	1.00
130_L	134_G	0.573	1.00
27_A	37_T	0.572	1.00
19_M	110_L	0.572	1.00
43_G	126_L	0.565	1.00
167_L	173_V	0.564	1.00
163_A	177_A	0.563	1.00
151_L	155_A	0.563	1.00
124_M	127_R	0.563	1.00
91_Q	100_L	0.558	1.00
87_A	138_A	0.556	1.00
85_L	88_G	0.554	1.00
8_M	143_L	0.554	1.00
146_L	154_M	0.553	1.00
43_G	47_V	0.552	1.00
62_L	67_L	0.551	1.00
77_P	81_G	0.544	1.00
144_F	148_V	0.541	1.00
142_L	181_L	0.538	1.00
62_L	79_L	0.536	1.00
3_M	59_Q	0.536	1.00
168_P	171_R	0.536	1.00
22_L	29_R	0.534	1.00
15_S	162_L	0.533	1.00
81_G	182_I	0.533	1.00
8_M	161_V	0.533	1.00
91_Q	135_C	0.531	1.00
19_M	109_F	0.530	1.00
37_T	41_V	0.526	1.00
154_M	158_A	0.525	1.00
70_P	73_A	0.520	1.00
75_A	79_L	0.520	1.00
159_A	163_A	0.519	1.00
96_K	135_C	0.517	1.00
19_M	128_H	0.514	1.00
21_L	26_V	0.512	1.00
3_M	150_N	0.511	1.00
130_L	133_V	0.510	1.00
117_G	124_M	0.510	1.00
160_L	173_V	0.508	1.00
160_L	174_A	0.506	1.00
47_V	51_F	0.504	1.00
80_A	83_V	0.503	1.00
158_A	161_V	0.502	1.00
150_N	153_W	0.500	0.99

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
4ogqB	1	0.3511	2.5	0.958	Contact Map
3wxwA	1	0.5266	1.5	0.963	Contact Map
2msqA	1	0.1223	1	0.967	Contact Map
1v54M	1	0.1383	0.9	0.968	Contact Map
1b4uB	2	0.3032	0.8	0.968	Contact Map
2mmuA	1	0.2287	0.8	0.968	Contact Map
2y69M	1	0.1383	0.7	0.97	Contact Map
2mn6B	2	0.2234	0.7	0.97	Contact Map
4rngA	2	0.4043	0.7	0.97	Contact Map
4g1uA	2	0.2553	0.7	0.971	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0069 seconds.