DUF2149 - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

DUF2149 - Uncharacterized conserved protein (DUF2149)

PFAM:	PF09919	Sequences: LDGVVNLFDVALVFAVALLLALVSSLNLTELLTPKEDVTIVKNPGKPNMEIIVKKGEEIERYKVTGEIGSGEGERLGTAYRLEDGRLIYVPE	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	92 (90)
Sequences:	2144 (1418)
Seq/√Len:	149.4
META:	0.873

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
75_R	78_T	4.266	1.00
74_E	81_R	3.580	1.00
14_F	18_L	3.144	1.00
79_A	87_L	3.119	1.00
1_L	5_V	3.040	1.00
8_F	11_A	2.692	1.00
72_E	83_E	2.673	1.00
37_D	55_K	2.433	1.00
8_F	12_L	2.103	1.00
4_V	8_F	2.059	1.00
18_L	22_L	2.031	1.00
76_L	87_L	1.660	1.00
79_A	89_Y	1.657	1.00
62_Y	65_T	1.653	1.00
30_E	33_T	1.561	1.00
43_N	46_K	1.441	1.00
4_V	7_L	1.418	1.00
16_V	19_L	1.394	1.00
63_K	66_G	1.350	1.00
4_V	10_V	1.317	1.00
58_E	86_R	1.312	1.00
42_K	52_I	1.248	1.00
75_R	79_A	1.227	1.00
22_L	26_L	1.200	1.00
55_K	60_E	1.178	1.00
79_A	82_L	1.166	1.00
82_L	89_Y	1.161	1.00
67_E	70_S	1.157	1.00
7_L	16_V	1.147	1.00
18_L	23_V	1.144	1.00
20_L	24_S	1.134	1.00
44_P	49_M	1.125	0.99
16_V	21_A	1.096	0.99
23_V	28_L	1.091	0.99
50_E	63_K	1.086	0.99
43_N	47_P	1.076	0.99
37_D	41_V	1.062	0.99
14_F	19_L	1.062	0.99
13_V	19_L	1.052	0.99
12_L	15_A	1.048	0.99
6_N	9_D	1.030	0.99
36_E	44_P	1.027	0.99
45_G	48_N	1.017	0.99
39_T	51_I	1.002	0.99
11_A	17_A	0.987	0.99
41_V	49_M	0.987	0.99
28_L	31_L	0.977	0.99
3_G	10_V	0.975	0.99
40_I	43_N	0.965	0.98
14_F	21_A	0.953	0.98
37_D	46_K	0.951	0.98
7_L	10_V	0.935	0.98
39_T	42_K	0.931	0.98
5_V	14_F	0.930	0.98
37_D	43_N	0.930	0.98
10_V	21_A	0.921	0.98
45_G	49_M	0.914	0.98
3_G	11_A	0.909	0.98
22_L	25_S	0.903	0.98
24_S	27_N	0.897	0.97
58_E	66_G	0.888	0.97
20_L	25_S	0.880	0.97
80_Y	85_G	0.875	0.97
44_P	50_E	0.874	0.97
36_E	42_K	0.817	0.96
47_P	50_E	0.816	0.96
39_T	43_N	0.816	0.96
35_K	60_E	0.811	0.95
68_I	72_E	0.808	0.95
31_L	38_V	0.805	0.95
76_L	81_R	0.804	0.95
42_K	61_R	0.782	0.94
37_D	45_G	0.773	0.94
40_I	54_K	0.766	0.94
37_D	40_I	0.756	0.93
82_L	86_R	0.755	0.93
39_T	54_K	0.752	0.93
16_V	26_L	0.749	0.93
44_P	48_N	0.734	0.92
4_V	20_L	0.722	0.92
8_F	16_V	0.719	0.91
57_E	66_G	0.709	0.91
42_K	83_E	0.707	0.91
21_A	79_A	0.686	0.89
38_V	54_K	0.682	0.89
77_G	85_G	0.681	0.89
37_D	56_G	0.678	0.89
24_S	33_T	0.675	0.89
7_L	20_L	0.672	0.88
39_T	50_E	0.664	0.88
41_V	45_G	0.660	0.88
83_E	88_I	0.657	0.87
40_I	45_G	0.650	0.87
11_A	84_D	0.644	0.86
44_P	47_P	0.643	0.86
38_V	41_V	0.633	0.85
25_S	29_T	0.625	0.85
82_L	87_L	0.614	0.84
32_L	38_V	0.613	0.83
75_R	89_Y	0.612	0.83
9_D	13_V	0.612	0.83
82_L	88_I	0.611	0.83
38_V	52_I	0.602	0.82
2_D	20_L	0.600	0.82
84_D	90_V	0.587	0.81
2_D	14_F	0.584	0.80
73_G	88_I	0.583	0.80
84_D	89_Y	0.582	0.80
82_L	91_P	0.581	0.80
85_G	90_V	0.577	0.80
28_L	40_I	0.575	0.79
55_K	64_V	0.570	0.79
5_V	13_V	0.567	0.78
43_N	49_M	0.561	0.78
87_L	91_P	0.560	0.78
73_G	82_L	0.559	0.78
35_K	72_E	0.558	0.77
14_F	20_L	0.557	0.77
39_T	49_M	0.546	0.76
73_G	81_R	0.541	0.75
53_V	67_E	0.541	0.75
77_G	80_Y	0.539	0.75
1_L	10_V	0.539	0.75
41_V	44_P	0.538	0.75
70_S	73_G	0.536	0.75
75_R	90_V	0.530	0.74
13_V	17_A	0.514	0.71
71_G	82_L	0.514	0.71
13_V	25_S	0.511	0.71
29_T	32_L	0.506	0.70
59_I	70_S	0.505	0.70
2_D	5_V	0.502	0.70
78_T	83_E	0.501	0.70
42_K	45_G	0.501	0.70
71_G	84_D	0.500	0.69

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
4jw1A	1	0.2065	16.2	0.899	Contact Map
4x2zA	1	0.4674	6.3	0.916	Contact Map
1v58A	2	0.5326	5.4	0.919	Contact Map
1j72A	2	0.2717	4.8	0.92	Contact Map
1scfA	4	0	4.3	0.923	Contact Map
4tllB	2	0.3587	4.2	0.923	Contact Map
3q6lA	1	0.913	3.9	0.924	Contact Map
3j6da	3	0.4348	3.8	0.925	Contact Map
2yheA	3	0.5761	3.6	0.926	Contact Map
4a60A	1	0.913	3.3	0.926	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0056 seconds.