HigB_toxin - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

HigB_toxin - HigB_toxin, RelE-like toxic component of a toxin-antitoxin system

PFAM:	PF09907	Sequences: AEQPLEAWYREVKKADWKSPADVKATFPSADIVGNNRVVFNIKGNKYRLIVAINYRRQIVYIRFIGTHAEYDKI	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	74 (72)
Sequences:	20612 (11802)
Seq/√Len:	1390.8
META:	0.951

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
2_E	6_E	2.722	1.00
43_K	46_K	2.543	1.00
54_N	57_R	2.290	1.00
53_I	60_V	2.246	1.00
12_V	17_W	2.180	1.00
7_A	11_E	2.043	1.00
38_V	55_Y	2.014	1.00
20_P	32_I	2.005	1.00
16_D	58_Q	1.967	1.00
18_K	22_D	1.950	1.00
11_E	26_T	1.851	1.00
31_D	41_N	1.700	1.00
30_A	38_V	1.658	1.00
4_P	43_K	1.619	1.00
52_A	63_R	1.519	1.00
19_S	22_D	1.492	1.00
3_Q	6_E	1.425	1.00
11_E	27_F	1.377	1.00
18_K	58_Q	1.373	1.00
9_Y	13_K	1.371	1.00
17_W	26_T	1.354	1.00
4_P	42_I	1.349	1.00
33_V	39_V	1.347	1.00
54_N	61_Y	1.295	1.00
38_V	53_I	1.292	1.00
29_S	41_N	1.251	1.00
12_V	60_V	1.236	1.00
37_R	52_A	1.217	1.00
32_I	35_N	1.179	1.00
69_A	72_D	1.155	1.00
15_A	26_T	1.125	1.00
23_V	38_V	1.125	1.00
3_Q	7_A	1.077	1.00
21_A	25_A	1.062	1.00
49_L	65_I	1.043	1.00
57_R	61_Y	1.034	1.00
5_L	42_I	1.032	1.00
50_I	64_F	1.031	1.00
54_N	59_I	1.024	1.00
35_N	52_A	1.020	1.00
6_E	10_R	0.968	1.00
40_F	51_V	0.959	1.00
24_K	31_D	0.958	1.00
32_I	38_V	0.955	1.00
31_D	39_V	0.939	1.00
8_W	40_F	0.930	1.00
20_P	24_K	0.915	1.00
51_V	60_V	0.914	1.00
20_P	55_Y	0.912	1.00
37_R	64_F	0.904	1.00
5_L	49_L	0.874	1.00
52_A	61_Y	0.866	1.00
37_R	63_R	0.857	1.00
7_A	10_R	0.850	1.00
36_N	52_A	0.831	1.00
22_D	25_A	0.825	1.00
37_R	50_I	0.823	1.00
52_A	59_I	0.821	1.00
42_I	49_L	0.812	1.00
9_Y	12_V	0.811	1.00
50_I	66_G	0.803	1.00
6_E	9_Y	0.801	1.00
8_W	12_V	0.798	1.00
67_T	70_E	0.782	1.00
54_N	63_R	0.774	1.00
69_A	73_K	0.745	1.00
5_L	65_I	0.731	1.00
37_R	66_G	0.718	1.00
12_V	49_L	0.717	1.00
17_W	23_V	0.715	1.00
24_K	41_N	0.704	1.00
33_V	37_R	0.693	1.00
39_V	50_I	0.688	1.00
23_V	53_I	0.681	1.00
10_R	14_K	0.674	1.00
4_P	44_G	0.672	1.00
4_P	47_Y	0.661	1.00
62_I	65_I	0.653	1.00
31_D	50_I	0.647	1.00
10_R	13_K	0.639	1.00
33_V	36_N	0.635	1.00
36_N	54_N	0.616	1.00
21_A	32_I	0.616	1.00
52_A	57_R	0.610	1.00
41_N	44_G	0.607	1.00
12_V	15_A	0.598	1.00
21_A	24_K	0.592	1.00
29_S	44_G	0.572	1.00
4_P	7_A	0.570	1.00
52_A	56_R	0.570	1.00
32_I	55_Y	0.560	1.00
34_G	37_R	0.560	1.00
20_P	31_D	0.548	1.00
29_S	43_K	0.546	1.00
64_F	72_D	0.537	1.00
2_E	9_Y	0.526	1.00
45_N	48_R	0.524	1.00
20_P	38_V	0.521	1.00
28_P	31_D	0.521	1.00
11_E	15_A	0.517	1.00
27_F	30_A	0.514	1.00
25_A	28_P	0.509	1.00
12_V	23_V	0.509	1.00
9_Y	65_I	0.507	1.00
56_R	59_I	0.502	1.00
24_K	29_S	0.501	1.00
43_K	47_Y	0.501	1.00
8_W	49_L	0.500	1.00

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3bpqB	1	0.9459	75	0.81	Contact Map
4nrnA	2	0.9459	74.2	0.811	Contact Map
3g5oB	1	0.8784	71.2	0.815	Contact Map
4fxiA	2	0.9865	62	0.827	Contact Map
4lttA	1	0.9595	61.8	0.827	Contact Map
2kheA	1	0.9595	53.7	0.835	Contact Map
1wmiA	2	0.9189	49.9	0.839	Contact Map
4ml2A	1	0.9459	32.9	0.855	Contact Map
3oeiC	2	0.8784	30.1	0.858	Contact Map
2a6sA	1	0.8784	20.6	0.869	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0044 seconds.