Peptidase_M76 - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Peptidase_M76 - Peptidase M76 family

PFAM:	PF09768	Sequences: KRCEKMVDWLLKYSPTVKFLLEALKKLGCPVDPSNISCEPCDGTVSGGFDPELGIVLCQNHIRSQGHVEDTLAHELIHAYDHCRAKVDWTNLRHHACSEIRAANLSGDCRFKRELLRGNGFFKFKKQHQECVRRRAILSVMANPNCKDDEEAEKAVDEVWDSCFNDTRPFD	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	171 (168)
Sequences:	559 (394)
Seq/√Len:	30.4
META:	0.24

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
104_N	128_H	4.449	1.00
29_C	83_C	4.169	1.00
93_R	158_E	3.691	1.00
41_C	58_C	3.655	1.00
133_R	157_D	3.070	1.00
137_I	156_V	2.838	1.00
74_H	78_H	2.811	1.00
55_I	76_L	2.686	1.00
75_E	78_H	2.632	1.00
91_N	94_H	2.618	1.00
65_Q	69_E	2.614	1.00
97_C	163_C	2.581	1.00
92_L	146_C	2.516	0.99
88_D	91_N	2.295	0.99
95_H	143_N	2.286	0.99
21_L	76_L	2.266	0.99
137_I	153_E	2.249	0.99
81_D	101_R	2.247	0.99
49_F	82_H	2.087	0.98
36_I	72_L	2.052	0.98
3_C	38_C	2.004	0.97
136_A	156_V	1.972	0.97
103_A	108_D	1.939	0.97
74_H	102_A	1.864	0.96
24_L	29_C	1.820	0.95
57_L	62_I	1.813	0.95
28_G	83_C	1.801	0.95
82_H	89_W	1.736	0.94
152_A	156_V	1.727	0.93
89_W	98_S	1.709	0.93
118_G	121_F	1.704	0.93
16_T	73_A	1.663	0.92
166_D	169_P	1.658	0.92
78_H	99_E	1.623	0.91
14_S	69_E	1.484	0.87
22_E	77_I	1.470	0.86
88_D	94_H	1.467	0.86
114_E	135_R	1.437	0.85
75_E	99_E	1.430	0.85
75_E	102_A	1.407	0.84
78_H	139_S	1.372	0.82
22_E	26_K	1.354	0.81
22_E	33_P	1.333	0.80
87_V	98_S	1.316	0.79
143_N	146_C	1.292	0.78
115_L	151_E	1.288	0.78
31_V	80_Y	1.273	0.77
62_I	68_V	1.273	0.77
154_K	158_E	1.272	0.77
50_D	53_L	1.268	0.77
100_I	160_W	1.245	0.75
74_H	99_E	1.244	0.75
96_A	156_V	1.228	0.74
114_E	134_R	1.226	0.74
132_V	136_A	1.210	0.73
32_D	83_C	1.202	0.73
80_Y	168_R	1.182	0.71
134_R	138_L	1.171	0.71
14_S	20_L	1.156	0.70
148_D	157_D	1.133	0.68
99_E	102_A	1.129	0.68
99_E	139_S	1.127	0.68
74_H	139_S	1.127	0.68
103_A	136_A	1.122	0.67
100_I	163_C	1.121	0.67
79_A	106_S	1.085	0.65
133_R	160_W	1.063	0.63
6_M	9_W	1.061	0.63
121_F	124_F	1.045	0.62
60_N	116_L	1.045	0.62
41_C	60_N	1.043	0.62
11_L	36_I	1.042	0.62
9_W	13_Y	1.026	0.60
43_G	124_F	1.018	0.60
23_A	26_K	1.014	0.59
96_A	136_A	1.006	0.59
40_P	59_Q	0.992	0.58
78_H	102_A	0.983	0.57
29_C	32_D	0.980	0.57
17_V	20_L	0.975	0.56
5_K	12_K	0.971	0.56
127_Q	130_E	0.947	0.54
147_K	151_E	0.931	0.53
75_E	139_S	0.930	0.53
93_R	159_V	0.926	0.53
28_G	79_A	0.922	0.52
106_S	135_R	0.915	0.52
18_K	22_E	0.914	0.52
21_L	30_P	0.910	0.51
140_V	143_N	0.903	0.51
68_V	164_F	0.900	0.50
18_K	25_K	0.897	0.50
100_I	115_L	0.893	0.50
108_D	135_R	0.892	0.50
158_E	164_F	0.890	0.50
114_E	127_Q	0.890	0.50
106_S	114_E	0.886	0.49
128_H	132_V	0.881	0.49
85_A	168_R	0.881	0.49
131_C	163_C	0.876	0.49
55_I	142_A	0.876	0.49
19_F	54_G	0.873	0.48
17_V	73_A	0.869	0.48
9_W	55_I	0.869	0.48
48_G	72_L	0.867	0.48
102_A	109_C	0.849	0.46
25_K	30_P	0.846	0.46
64_S	67_H	0.842	0.46
2_R	5_K	0.831	0.45
32_D	35_N	0.827	0.45
141_M	149_D	0.827	0.45
31_V	103_A	0.824	0.44
56_V	103_A	0.823	0.44
129_Q	164_F	0.818	0.44
91_N	133_R	0.800	0.43
140_V	146_C	0.799	0.42
117_R	134_R	0.793	0.42
37_S	80_Y	0.790	0.42
5_K	9_W	0.789	0.42
10_L	69_E	0.788	0.42
96_A	152_A	0.775	0.41
101_R	105_L	0.774	0.40
39_E	50_D	0.772	0.40
108_D	114_E	0.763	0.40
19_F	161_D	0.755	0.39
36_I	77_I	0.752	0.39
108_D	117_R	0.749	0.39
12_K	25_K	0.749	0.39
80_Y	147_K	0.748	0.39
46_S	67_H	0.744	0.38
12_K	22_E	0.743	0.38
36_I	61_H	0.738	0.38
7_V	57_L	0.737	0.38
68_V	72_L	0.733	0.37
38_C	96_A	0.729	0.37
134_R	144_P	0.723	0.37
20_L	30_P	0.722	0.37
47_G	71_T	0.720	0.36
17_V	24_L	0.719	0.36
30_P	76_L	0.716	0.36
148_D	151_E	0.715	0.36
44_T	137_I	0.710	0.36
112_K	116_L	0.705	0.35
59_Q	84_R	0.704	0.35
96_A	140_V	0.704	0.35
42_D	142_A	0.701	0.35
155_A	158_E	0.690	0.34
10_L	14_S	0.687	0.34
85_A	124_F	0.685	0.34
71_T	87_V	0.677	0.33
18_K	168_R	0.677	0.33
126_K	133_R	0.674	0.33
108_D	143_N	0.671	0.33
67_H	140_V	0.670	0.33
101_R	109_C	0.670	0.33
81_D	96_A	0.667	0.33
136_A	152_A	0.666	0.33
52_E	145_N	0.664	0.32
163_C	169_P	0.663	0.32
113_R	127_Q	0.663	0.32
54_G	168_R	0.662	0.32
153_E	162_S	0.661	0.32
104_N	164_F	0.658	0.32
105_L	135_R	0.657	0.32
138_L	161_D	0.652	0.32
67_H	113_R	0.652	0.32
149_D	153_E	0.649	0.31
53_L	112_K	0.648	0.31
9_W	65_Q	0.644	0.31
43_G	46_S	0.642	0.31
8_D	91_N	0.641	0.31
99_E	136_A	0.640	0.31
134_R	143_N	0.639	0.31
2_R	59_Q	0.638	0.31
136_A	140_V	0.635	0.30
19_F	95_H	0.634	0.30
15_P	167_T	0.633	0.30
167_T	170_F	0.631	0.30
35_N	59_Q	0.628	0.30
11_L	33_P	0.627	0.30
83_C	103_A	0.625	0.30
63_R	116_L	0.622	0.30
89_W	104_N	0.618	0.29
126_K	129_Q	0.617	0.29
28_G	80_Y	0.616	0.29
48_G	135_R	0.616	0.29
99_E	109_C	0.614	0.29
140_V	156_V	0.611	0.29
83_C	163_C	0.609	0.29
55_I	68_V	0.609	0.29
39_E	56_V	0.606	0.28
2_R	141_M	0.604	0.28
9_W	12_K	0.604	0.28
92_L	148_D	0.604	0.28
43_G	165_N	0.603	0.28
7_V	18_K	0.600	0.28
63_R	67_H	0.598	0.28
35_N	77_I	0.593	0.28
11_L	21_L	0.593	0.28
6_M	65_Q	0.590	0.27
55_I	62_I	0.587	0.27
94_H	135_R	0.579	0.27
162_S	168_R	0.577	0.27
15_P	57_L	0.576	0.27
57_L	61_H	0.576	0.27
97_C	100_I	0.574	0.26
153_E	157_D	0.573	0.26
36_I	162_S	0.573	0.26
20_L	40_P	0.572	0.26
62_I	164_F	0.569	0.26
24_L	83_C	0.568	0.26
62_I	113_R	0.567	0.26
12_K	157_D	0.566	0.26
55_I	141_M	0.562	0.26
32_D	103_A	0.561	0.26
40_P	55_I	0.560	0.26
43_G	122_F	0.560	0.26
7_V	93_R	0.557	0.25
95_H	146_C	0.557	0.25
24_L	80_Y	0.554	0.25
123_K	130_E	0.554	0.25
92_L	155_A	0.548	0.25
89_W	95_H	0.547	0.25
5_K	161_D	0.543	0.25
106_S	170_F	0.543	0.25
44_T	61_H	0.538	0.24
79_A	135_R	0.538	0.24
19_F	165_N	0.535	0.24
21_L	40_P	0.533	0.24
51_P	159_V	0.532	0.24
33_P	165_N	0.531	0.24
42_D	84_R	0.530	0.24
98_S	101_R	0.530	0.24
81_D	166_D	0.528	0.24
20_L	77_I	0.526	0.24
68_V	73_A	0.525	0.23
2_R	13_Y	0.523	0.23
130_E	165_N	0.518	0.23
141_M	146_C	0.516	0.23
20_L	51_P	0.516	0.23
105_L	114_E	0.516	0.23
79_A	102_A	0.513	0.23
133_R	144_P	0.513	0.23
59_Q	110_R	0.513	0.23
115_L	165_N	0.508	0.23
67_H	158_E	0.507	0.22
97_C	109_C	0.506	0.22
60_N	128_H	0.505	0.22
4_E	40_P	0.505	0.22
71_T	168_R	0.503	0.22
114_E	117_R	0.502	0.22
7_V	36_I	0.500	0.22

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2x3cA	2	0.6784	75.9	0.92	Contact Map
1g12A	1	0.6842	45.5	0.934	Contact Map
1eb6A	1	0.7135	40.7	0.936	Contact Map
3cqbA	4	0.5205	23.6	0.943	Contact Map
4jiuA	1	0.5906	14.4	0.949	Contact Map
4dv8A	1	0.8713	11.9	0.95	Contact Map
4jixA	2	0.6199	10.1	0.952	Contact Map
5a0rA	1	0.7076	6.4	0.956	Contact Map
1r1hA	1	0.848	4.7	0.959	Contact Map
4qhjA	2	0.5906	4.5	0.959	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0067 seconds.