CPW_WPC - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

CPW_WPC - Plasmodium falciparum domain of unknown function (CPW_WPC)

PFAM:	PF09717	Sequences: CERDYSAPCPEGWTEGGGGTCVAPSSYNGPCGRKIDFSNMTPEEKKAWAKKCGVSWPCK	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	59 (58)
Sequences:	674 (564)
Seq/√Len:	74.1
META:	0.375

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
1_C	58_C	3.809	1.00
31_C	52_C	2.986	1.00
13_W	24_P	2.986	1.00
48_W	54_V	2.653	1.00
41_T	44_E	2.604	1.00
3_R	49_A	2.078	1.00
5_Y	49_A	2.024	1.00
23_A	32_G	1.886	1.00
37_F	48_W	1.786	1.00
40_M	44_E	1.764	1.00
47_A	51_K	1.645	1.00
27_Y	30_P	1.639	1.00
27_Y	31_C	1.638	1.00
35_I	48_W	1.618	1.00
49_A	55_S	1.591	0.99
23_A	27_Y	1.504	0.99
4_D	7_A	1.341	0.98
44_E	56_W	1.235	0.97
12_G	57_P	1.232	0.97
43_E	47_A	1.200	0.96
7_A	56_W	1.112	0.94
25_S	37_F	1.109	0.94
9_C	21_C	1.090	0.93
33_R	53_G	1.081	0.93
31_C	45_K	1.072	0.93
11_E	57_P	1.038	0.92
24_P	27_Y	1.002	0.90
20_T	39_N	1.002	0.90
22_V	39_N	0.972	0.89
3_R	22_V	0.970	0.89
32_G	35_I	0.955	0.88
3_R	55_S	0.951	0.88
4_D	19_G	0.923	0.86
13_W	54_V	0.918	0.86
48_W	53_G	0.878	0.83
16_G	20_T	0.859	0.82
17_G	41_T	0.822	0.79
49_A	54_V	0.821	0.79
12_G	51_K	0.817	0.79
14_T	38_S	0.793	0.76
13_W	48_W	0.783	0.76
25_S	34_K	0.779	0.75
5_Y	46_K	0.760	0.73
20_T	33_R	0.737	0.71
16_G	19_G	0.729	0.70
16_G	34_K	0.710	0.68
42_P	46_K	0.704	0.68
28_N	39_N	0.694	0.66
3_R	13_W	0.689	0.66
46_K	49_A	0.676	0.64
21_C	45_K	0.675	0.64
16_G	22_V	0.671	0.64
26_S	53_G	0.661	0.63
43_E	46_K	0.654	0.62
26_S	45_K	0.646	0.61
7_A	46_K	0.646	0.61
11_E	48_W	0.644	0.61
12_G	32_G	0.636	0.60
15_E	25_S	0.631	0.59
45_K	52_C	0.624	0.58
1_C	6_S	0.616	0.57
15_E	18_G	0.614	0.57
29_G	54_V	0.607	0.56
15_E	39_N	0.603	0.56
27_Y	54_V	0.594	0.55
15_E	47_A	0.593	0.54
46_K	50_K	0.592	0.54
27_Y	37_F	0.584	0.53
1_C	15_E	0.566	0.51
18_G	39_N	0.563	0.51
43_E	55_S	0.552	0.49
20_T	34_K	0.543	0.48
21_C	31_C	0.542	0.48
18_G	33_R	0.541	0.48
12_G	46_K	0.540	0.48
11_E	19_G	0.537	0.47
8_P	20_T	0.533	0.47
45_K	49_A	0.530	0.47
8_P	40_M	0.525	0.46
5_Y	43_E	0.524	0.46
2_E	51_K	0.518	0.45
2_E	5_Y	0.512	0.44
8_P	44_E	0.508	0.44
24_P	33_R	0.504	0.43
6_S	18_G	0.501	0.43
2_E	50_K	0.500	0.43
17_G	56_W	0.500	0.43

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3v64C	1	0.4915	15.9	0.838	Contact Map
3s94A	1	0.4068	7.4	0.86	Contact Map
1ijqA	1	0.3898	5.4	0.869	Contact Map
1b1vA	1	0.3898	4.5	0.874	Contact Map
1ahlA	1	0.4915	4.1	0.876	Contact Map
3u2sG	1	0.7458	3.9	0.878	Contact Map
3p5bL	1	0.4237	3.7	0.878	Contact Map
3v65B	1	0.3898	3.4	0.881	Contact Map
1bhpA	3	0.2542	2.9	0.885	Contact Map
4xlwB	2	0.7119	2.7	0.887	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0046 seconds.