Cas_CXXC_CXXC - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Cas_CXXC_CXXC - CRISPR-associated protein (Cas_CXXC_CXXC)

PFAM:	PF09706	Sequences: KSKSKYNCIFCGRRPSKKLKNDLSFLNRTGFPLTGSVGRKSNFFWNFNNDAPICPICALIYQCSPLGFT	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	69 (67)
Sequences:	599 (458)
Seq/√Len:	55.9
META:	0.79

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
54_C	57_C	4.099	1.00
11_C	54_C	3.488	1.00
11_C	57_C	3.414	1.00
36_S	40_K	2.515	1.00
36_S	42_N	2.454	1.00
56_I	59_L	2.120	1.00
60_I	63_C	2.072	1.00
33_L	61_Y	1.978	1.00
26_L	64_S	1.862	0.99
21_N	49_N	1.819	0.99
31_F	58_A	1.808	0.99
18_K	21_N	1.722	0.99
10_F	53_I	1.504	0.98
53_I	56_I	1.422	0.97
46_N	56_I	1.419	0.97
56_I	60_I	1.415	0.97
33_L	65_P	1.385	0.96
35_G	39_R	1.335	0.95
28_R	31_F	1.314	0.95
34_T	53_I	1.289	0.94
36_S	39_R	1.288	0.94
64_S	68_F	1.282	0.94
8_C	54_C	1.265	0.94
3_K	7_N	1.219	0.92
45_W	60_I	1.211	0.92
8_C	11_C	1.194	0.91
7_N	12_G	1.163	0.90
7_N	13_R	1.106	0.88
7_N	20_K	1.091	0.87
16_S	20_K	1.075	0.86
33_L	50_D	1.071	0.86
8_C	57_C	1.057	0.86
33_L	39_R	1.033	0.84
16_S	19_L	1.023	0.84
45_W	61_Y	1.006	0.83
7_N	15_P	0.959	0.79
6_Y	24_S	0.952	0.79
39_R	42_N	0.951	0.79
9_I	49_N	0.886	0.74
52_P	69_T	0.869	0.72
32_P	50_D	0.869	0.72
44_F	55_P	0.858	0.71
23_L	26_L	0.846	0.70
55_P	63_C	0.844	0.70
14_R	20_K	0.833	0.69
31_F	44_F	0.805	0.66
25_F	30_G	0.775	0.64
4_S	19_L	0.770	0.63
9_I	52_P	0.769	0.63
5_K	67_G	0.758	0.62
38_G	64_S	0.745	0.60
9_I	48_N	0.737	0.60
39_R	55_P	0.717	0.58
41_S	63_C	0.699	0.56
34_T	40_K	0.698	0.55
44_F	51_A	0.682	0.54
50_D	61_Y	0.681	0.54
37_V	43_F	0.678	0.53
32_P	36_S	0.678	0.53
22_D	37_V	0.671	0.53
25_F	31_F	0.669	0.52
30_G	63_C	0.656	0.51
4_S	14_R	0.648	0.50
30_G	47_F	0.646	0.50
28_R	62_Q	0.643	0.50
15_P	18_K	0.623	0.47
41_S	49_N	0.613	0.46
9_I	51_A	0.611	0.46
61_Y	68_F	0.610	0.46
31_F	66_L	0.607	0.46
55_P	62_Q	0.605	0.45
17_K	29_T	0.602	0.45
40_K	44_F	0.600	0.45
48_N	51_A	0.598	0.45
18_K	29_T	0.596	0.44
45_W	63_C	0.596	0.44
37_V	44_F	0.594	0.44
47_F	59_L	0.579	0.43
42_N	62_Q	0.567	0.41
55_P	68_F	0.564	0.41
45_W	50_D	0.560	0.41
15_P	19_L	0.559	0.41
61_Y	64_S	0.558	0.40
39_R	67_G	0.557	0.40
26_L	31_F	0.543	0.39
12_G	32_P	0.541	0.39
15_P	21_N	0.531	0.38
12_G	37_V	0.526	0.37
6_Y	45_W	0.521	0.37
43_F	60_I	0.521	0.37
18_K	49_N	0.518	0.36
34_T	46_N	0.516	0.36
15_P	53_I	0.515	0.36
58_A	61_Y	0.514	0.36
63_C	66_L	0.511	0.36
28_R	60_I	0.510	0.36
47_F	52_P	0.510	0.36
30_G	44_F	0.508	0.35
21_N	24_S	0.506	0.35
43_F	51_A	0.500	0.35

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
1ovxA	2	0.5507	9.2	0.874	Contact Map
3zmsC	1	0	9	0.875	Contact Map
1dx8A	1	0.8116	8.2	0.877	Contact Map
4a17Y	1	0.5942	4.6	0.891	Contact Map
4w20p	1	0.5942	4.4	0.892	Contact Map
4lqxA	2	0.3623	4.3	0.892	Contact Map
3x1lA	1	0.7536	4.1	0.893	Contact Map
2lt7A	1	0.8261	4	0.894	Contact Map
4ujrc	1	0.5942	4	0.894	Contact Map
2kn9A	1	0.8116	3.7	0.895	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0047 seconds.