Tail_P2_I - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Tail_P2_I - Phage tail protein (Tail_P2_I)

PFAM:	PF09684	Sequences: LPPNATALERALAAALARLDDLPVPLRALFDPDTCPEDFLPWLAWWLGVDRWDEDWPEERKRALIKNAIELHRRRGTPAALRRALEALGGGVEIVEWFEYGEPYTFRVRVDVSDRGITEETYARLRRLIEAAKPAR	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	136 (127)
Sequences:	5344 (4254)
Seq/√Len:	377.5
META:	0.759

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
33_D	66_K	5.187	1.00
37_E	58_E	5.071	1.00
74_R	79_A	3.389	1.00
67_N	83_R	3.365	1.00
57_P	60_R	3.341	1.00
31_D	34_T	3.145	1.00
78_P	82_R	2.954	1.00
79_A	83_R	2.395	1.00
83_R	86_E	2.322	1.00
63_A	67_N	2.068	1.00
93_E	109_R	2.008	1.00
30_F	46_W	1.977	1.00
126_R	130_E	1.964	1.00
41_P	61_K	1.873	1.00
104_Y	134_P	1.870	1.00
95_V	107_R	1.815	1.00
100_Y	105_T	1.716	1.00
59_E	63_A	1.709	1.00
48_G	72_H	1.694	1.00
26_L	30_F	1.693	1.00
67_N	70_E	1.640	1.00
68_A	72_H	1.632	1.00
58_E	62_R	1.632	1.00
49_V	68_A	1.617	1.00
70_E	74_R	1.586	1.00
121_T	124_R	1.501	1.00
95_V	109_R	1.484	1.00
118_T	121_T	1.484	1.00
100_Y	107_R	1.480	1.00
74_R	83_R	1.438	1.00
48_G	75_R	1.378	1.00
50_D	75_R	1.298	1.00
119_E	123_A	1.292	1.00
9_E	13_A	1.276	1.00
13_A	16_L	1.256	1.00
85_L	125_L	1.203	1.00
47_L	69_I	1.191	1.00
18_R	21_D	1.188	1.00
14_A	18_R	1.170	1.00
124_R	127_R	1.165	1.00
74_R	80_A	1.141	1.00
42_W	45_W	1.138	1.00
70_E	79_A	1.135	1.00
49_V	64_L	1.128	1.00
44_A	52_W	1.122	1.00
71_L	87_A	1.100	1.00
36_P	39_F	1.096	1.00
86_E	91_G	1.092	1.00
28_A	34_T	1.087	1.00
69_I	73_R	1.080	1.00
40_L	58_E	1.068	1.00
85_L	92_V	1.062	1.00
67_N	71_L	1.056	1.00
15_A	20_D	1.054	1.00
53_D	124_R	1.050	1.00
18_R	23_P	1.044	1.00
16_L	20_D	1.039	1.00
106_F	133_K	1.017	1.00
13_A	20_D	1.012	1.00
102_E	105_T	0.981	1.00
122_Y	126_R	0.979	1.00
67_N	87_A	0.971	1.00
32_P	35_C	0.966	1.00
96_E	134_P	0.960	1.00
64_L	84_A	0.956	1.00
19_L	23_P	0.942	1.00
78_P	94_I	0.937	1.00
10_R	13_A	0.932	1.00
129_I	133_K	0.925	1.00
56_W	60_R	0.924	1.00
130_E	133_K	0.921	1.00
25_P	28_A	0.915	1.00
40_L	65_I	0.892	1.00
52_W	61_K	0.890	1.00
47_L	65_I	0.889	1.00
14_A	17_A	0.884	1.00
17_A	20_D	0.878	1.00
31_D	35_C	0.867	1.00
16_L	19_L	0.862	1.00
70_E	73_R	0.848	1.00
13_A	18_R	0.834	1.00
116_G	119_E	0.833	1.00
56_W	61_K	0.831	1.00
37_E	65_I	0.828	1.00
15_A	18_R	0.823	1.00
82_R	86_E	0.815	1.00
70_E	83_R	0.810	1.00
37_E	61_K	0.804	1.00
80_A	132_A	0.801	1.00
60_R	63_A	0.799	1.00
118_T	122_Y	0.789	1.00
14_A	19_L	0.787	1.00
87_A	90_G	0.782	1.00
108_V	129_I	0.778	1.00
56_W	64_L	0.766	1.00
15_A	19_L	0.765	1.00
33_D	63_A	0.764	1.00
14_A	20_D	0.762	1.00
82_R	94_I	0.759	1.00
20_D	23_P	0.757	1.00
12_L	15_A	0.753	1.00
26_L	39_F	0.751	1.00
58_E	61_K	0.748	1.00
56_W	88_L	0.739	1.00
33_D	62_R	0.736	1.00
30_F	35_C	0.735	1.00
104_Y	108_V	0.734	1.00
117_I	122_Y	0.729	1.00
19_L	24_V	0.724	1.00
17_A	21_D	0.722	1.00
123_A	126_R	0.721	1.00
81_L	85_L	0.714	1.00
106_F	113_S	0.711	1.00
63_A	66_K	0.711	1.00
60_R	64_L	0.710	1.00
85_L	90_G	0.709	1.00
125_L	129_I	0.708	1.00
12_L	16_L	0.702	0.99
35_C	39_F	0.693	0.99
128_L	132_A	0.690	0.99
13_A	17_A	0.689	0.99
30_F	47_L	0.688	0.99
78_P	99_E	0.682	0.99
52_W	56_W	0.676	0.99
84_A	128_L	0.665	0.99
93_E	111_D	0.665	0.99
123_A	127_R	0.663	0.99
20_D	24_V	0.662	0.99
13_A	19_L	0.650	0.99
41_P	52_W	0.648	0.99
79_A	82_R	0.639	0.99
11_A	17_A	0.629	0.99
51_R	56_W	0.626	0.99
35_C	46_W	0.621	0.99
120_E	124_R	0.618	0.99
10_R	14_A	0.616	0.99
78_P	96_E	0.616	0.99
124_R	128_L	0.614	0.99
18_R	22_L	0.610	0.99
32_P	62_R	0.606	0.98
22_L	25_P	0.605	0.98
117_I	120_E	0.603	0.98
72_H	75_R	0.602	0.98
75_R	132_A	0.602	0.98
101_G	107_R	0.597	0.98
51_R	71_L	0.594	0.98
14_A	21_D	0.594	0.98
53_D	56_W	0.592	0.98
83_R	87_A	0.591	0.98
9_E	16_L	0.588	0.98
11_A	19_L	0.578	0.98
109_R	113_S	0.578	0.98
117_I	121_T	0.575	0.98
107_R	110_V	0.575	0.98
119_E	122_Y	0.574	0.98
35_C	58_E	0.569	0.98
64_L	71_L	0.568	0.98
27_R	30_F	0.567	0.98
16_L	23_P	0.563	0.98
116_G	121_T	0.562	0.98
29_L	46_W	0.555	0.97
47_L	68_A	0.550	0.97
46_W	69_I	0.550	0.97
63_A	89_G	0.549	0.97
64_L	87_A	0.547	0.97
42_W	56_W	0.547	0.97
114_D	118_T	0.543	0.97
21_D	25_P	0.542	0.97
15_A	25_P	0.541	0.97
15_A	23_P	0.540	0.97
85_L	94_I	0.538	0.97
90_G	111_D	0.535	0.97
14_A	22_L	0.531	0.97
98_F	104_Y	0.529	0.96
15_A	22_L	0.527	0.96
125_L	128_L	0.527	0.96
16_L	24_V	0.523	0.96
11_A	20_D	0.520	0.96
9_E	20_D	0.515	0.96
82_R	93_E	0.512	0.96
103_P	108_V	0.512	0.96
127_R	131_A	0.512	0.96
120_E	123_A	0.512	0.96
85_L	110_V	0.511	0.96
28_A	32_P	0.511	0.96
58_E	65_I	0.510	0.96
111_D	115_R	0.509	0.96
19_L	25_P	0.508	0.96
42_W	46_W	0.503	0.95
71_L	132_A	0.500	0.95

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
1h2vC	1	0.8971	13	0.912	Contact Map
1hf2A	2	0.4559	8.3	0.92	Contact Map
2m4iA	1	0.5588	7	0.922	Contact Map
1vzyA	3	0.8162	4.6	0.929	Contact Map
4u5rA	3	0.6544	4.5	0.929	Contact Map
2qgqA	1	0.8382	4.3	0.93	Contact Map
1dq3A	1	0.9926	4.2	0.93	Contact Map
3peiA	5	0.5809	4.1	0.931	Contact Map
1oltA	1	0.8603	4.1	0.931	Contact Map
3or1B	2	0.6691	4	0.931	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0059 seconds.