Spore_GerQ - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Spore_GerQ - Spore coat protein (Spore_GerQ)

PFAM:	PF09671	Sequences: MEQSYIENILRLNKGKLATVYMTFENNNEWNAKVFKGIIEAAGRDHIILSDPQTGKRYLLLMIYLDYVTFDEEINY	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	76 (75)
Sequences:	534 (251)
Seq/√Len:	28.9
META:	0.648

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
22_M	60_L	3.961	1.00
27_N	32_A	2.904	1.00
41_A	57_R	2.713	1.00
65_L	68_V	2.702	1.00
50_S	55_G	2.272	0.99
24_F	35_F	2.169	0.98
27_N	31_N	1.963	0.96
40_E	50_S	1.803	0.94
17_L	38_I	1.770	0.93
56_K	69_T	1.748	0.93
20_V	49_L	1.666	0.91
27_N	30_W	1.642	0.91
47_I	61_L	1.629	0.90
51_D	56_K	1.625	0.90
19_T	36_K	1.625	0.90
56_K	71_D	1.477	0.85
26_N	32_A	1.453	0.84
18_A	39_I	1.439	0.84
32_A	64_Y	1.427	0.83
40_E	52_P	1.423	0.83
51_D	58_Y	1.395	0.82
20_V	24_F	1.381	0.81
16_K	72_E	1.377	0.81
20_V	47_I	1.374	0.81
68_V	74_I	1.261	0.75
38_I	52_P	1.256	0.74
23_T	66_D	1.254	0.74
22_M	35_F	1.236	0.73
40_E	57_R	1.214	0.72
6_I	61_L	1.190	0.70
21_Y	30_W	1.169	0.69
36_K	71_D	1.110	0.65
27_N	64_Y	1.098	0.64
22_M	65_L	1.088	0.63
26_N	31_N	1.088	0.63
6_I	11_R	1.056	0.61
28_N	31_N	1.051	0.60
30_W	34_V	1.050	0.60
7_E	44_R	0.960	0.53
23_T	31_N	0.951	0.53
14_K	74_I	0.928	0.51
41_A	67_Y	0.917	0.50
60_L	65_L	0.906	0.49
53_Q	75_N	0.904	0.49
26_N	64_Y	0.889	0.48
4_S	11_R	0.879	0.47
42_A	65_L	0.874	0.47
25_E	32_A	0.864	0.46
11_R	46_H	0.864	0.46
23_T	26_N	0.849	0.45
20_V	39_I	0.834	0.44
25_E	31_N	0.814	0.42
6_I	46_H	0.813	0.42
33_K	67_Y	0.804	0.41
52_P	55_G	0.801	0.41
26_N	30_W	0.799	0.41
51_D	54_T	0.797	0.41
19_T	69_T	0.792	0.40
35_F	60_L	0.792	0.40
8_N	11_R	0.778	0.39
21_Y	34_V	0.777	0.39
39_I	47_I	0.750	0.37
24_F	64_Y	0.741	0.37
9_I	59_L	0.739	0.36
7_E	43_G	0.739	0.36
64_Y	73_E	0.737	0.36
54_T	58_Y	0.727	0.36
50_S	57_R	0.726	0.36
38_I	50_S	0.721	0.35
9_I	70_F	0.711	0.34
24_F	73_E	0.706	0.34
14_K	39_I	0.702	0.34
18_A	48_I	0.697	0.33
28_N	32_A	0.696	0.33
30_W	33_K	0.683	0.32
39_I	74_I	0.681	0.32
24_F	61_L	0.675	0.32
20_V	68_V	0.671	0.32
2_E	7_E	0.666	0.31
42_A	62_M	0.659	0.31
18_A	68_V	0.656	0.31
19_T	34_V	0.644	0.30
13_N	70_F	0.644	0.30
35_F	67_Y	0.637	0.29
31_N	34_V	0.629	0.29
4_S	59_L	0.629	0.29
26_N	71_D	0.626	0.29
12_L	41_A	0.600	0.27
23_T	28_N	0.589	0.26
41_A	73_E	0.587	0.26
30_W	51_D	0.568	0.25
39_I	52_P	0.561	0.25
20_V	65_L	0.558	0.25
57_R	73_E	0.552	0.24
23_T	27_N	0.549	0.24
14_K	42_A	0.548	0.24
9_I	62_M	0.547	0.24
17_L	72_E	0.544	0.24
35_F	63_I	0.543	0.24
27_N	66_D	0.538	0.23
28_N	33_K	0.535	0.23
60_L	66_D	0.532	0.23
17_L	36_K	0.529	0.23
25_E	64_Y	0.519	0.22
29_E	71_D	0.517	0.22
2_E	16_K	0.514	0.22
50_S	54_T	0.513	0.22
54_T	63_I	0.509	0.22
26_N	29_E	0.505	0.22
17_L	73_E	0.505	0.22
36_K	53_Q	0.500	0.21
29_E	32_A	0.500	0.21

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
1ycyA	5	0.75	32	0.902	Contact Map
1ib8A	1	0.9079	17.6	0.914	Contact Map
4pnoA	3	0.8289	14	0.917	Contact Map
4x9cA	3	0.7632	13.5	0.918	Contact Map
3bmaA	6	0.9474	13.4	0.918	Contact Map
2y90A	3	0.8289	8.4	0.925	Contact Map
4nl2D	3	0.8553	8.1	0.926	Contact Map
3ahuA	3	0.8553	8	0.926	Contact Map
1kq1A	5	0.7895	7.8	0.926	Contact Map
1u1sA	3	0.8421	7.3	0.927	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0043 seconds.