DUF2393 - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

DUF2393 - Protein of unknown function (DUF2393)

PFAM:	PF09624	Sequences: FILLIILAILLRKKKILALSMIFLSFLVLLLGPVFGYIVLDKYTKKAKLELLSQKRLLFTEAIVVKGTIKNEGKFDIGKCKLEIKLVNKGHNKKYKNYLYKLKPFKKKSFIIAKNLKPGESKEFKVIFEYPPYFKDYNISLKAECH	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	146 (145)
Sequences:	660 (538)
Seq/√Len:	44.7
META:	0.848

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
67_G	124_F	6.154	1.00
48_K	72_E	3.329	1.00
80_C	145_C	3.255	1.00
39_V	42_K	3.175	1.00
76_D	118_P	2.973	1.00
70_K	121_S	2.908	1.00
37_Y	41_D	2.652	1.00
16_I	20_S	2.454	1.00
73_G	77_I	2.420	1.00
84_I	126_V	2.402	1.00
9_I	12_R	2.374	1.00
41_D	45_K	2.267	1.00
83_E	107_K	2.187	1.00
95_Y	99_L	2.142	1.00
14_K	17_L	2.017	0.99
31_L	34_V	1.971	0.99
11_L	14_K	1.883	0.99
62_A	129_E	1.871	0.99
57_L	60_T	1.851	0.99
21_M	24_L	1.819	0.99
7_L	11_L	1.715	0.98
7_L	10_L	1.707	0.98
50_E	70_K	1.701	0.98
47_A	143_A	1.560	0.96
24_L	141_L	1.559	0.96
50_E	72_E	1.540	0.96
8_A	15_K	1.511	0.95
8_A	13_K	1.509	0.95
5_I	8_A	1.465	0.95
82_L	141_L	1.427	0.94
11_L	15_K	1.424	0.94
5_I	11_L	1.423	0.94
108_K	132_P	1.404	0.93
44_T	75_F	1.384	0.93
63_I	86_L	1.378	0.93
50_E	69_I	1.351	0.92
23_F	27_L	1.347	0.92
31_L	35_F	1.327	0.91
37_Y	45_K	1.304	0.90
25_S	32_G	1.282	0.90
87_V	140_S	1.280	0.89
63_I	105_F	1.278	0.89
51_L	65_V	1.270	0.89
9_I	15_K	1.268	0.89
47_A	77_I	1.251	0.88
44_T	58_L	1.217	0.87
12_R	15_K	1.215	0.87
42_K	112_I	1.210	0.87
101_K	104_P	1.202	0.86
82_L	119_G	1.201	0.86
19_L	23_F	1.199	0.86
84_I	128_F	1.192	0.86
20_S	24_L	1.191	0.86
111_I	126_V	1.179	0.85
6_I	10_L	1.135	0.83
20_S	23_F	1.119	0.82
8_A	12_R	1.109	0.81
64_V	125_K	1.096	0.81
117_K	120_E	1.096	0.81
74_K	120_E	1.093	0.80
36_G	41_D	1.081	0.80
131_P	137_Y	1.075	0.79
22_I	26_F	1.069	0.79
94_K	97_N	1.055	0.78
83_E	126_V	1.054	0.78
4_L	10_L	1.054	0.78
52_L	74_K	1.036	0.77
2_I	9_I	1.029	0.76
96_K	103_K	1.024	0.76
113_A	122_K	1.023	0.76
97_N	101_K	1.003	0.74
35_F	81_K	1.002	0.74
11_L	16_I	0.999	0.74
51_L	55_K	0.989	0.73
8_A	14_K	0.975	0.72
88_N	100_Y	0.974	0.72
98_Y	101_K	0.973	0.72
72_E	119_G	0.966	0.71
20_S	46_K	0.964	0.71
8_A	11_L	0.962	0.71
74_K	101_K	0.961	0.71
61_E	67_G	0.960	0.71
65_V	82_L	0.954	0.71
128_F	137_Y	0.946	0.70
24_L	94_K	0.938	0.69
64_V	127_I	0.931	0.69
34_V	38_I	0.930	0.69
9_I	14_K	0.908	0.67
10_L	15_K	0.904	0.66
20_S	28_V	0.904	0.66
3_L	42_K	0.884	0.65
13_K	17_L	0.878	0.64
22_I	118_P	0.868	0.63
111_I	132_P	0.863	0.63
29_L	94_K	0.854	0.62
3_L	6_I	0.846	0.61
37_Y	86_L	0.845	0.61
81_K	126_V	0.837	0.60
23_F	31_L	0.837	0.60
1_F	13_K	0.837	0.60
30_L	74_K	0.833	0.60
31_L	70_K	0.825	0.59
69_I	90_G	0.825	0.59
5_I	12_R	0.821	0.59
14_K	20_S	0.815	0.58
24_L	27_L	0.804	0.57
10_L	13_K	0.802	0.57
138_N	145_C	0.789	0.56
24_L	111_I	0.788	0.56
18_A	22_I	0.772	0.54
13_K	16_I	0.770	0.54
27_L	31_L	0.769	0.54
4_L	11_L	0.760	0.53
78_G	113_A	0.758	0.53
98_Y	103_K	0.758	0.53
22_I	39_V	0.751	0.52
61_E	132_P	0.743	0.51
38_I	76_D	0.741	0.51
129_E	137_Y	0.739	0.51
89_K	138_N	0.736	0.51
141_L	144_E	0.735	0.51
87_V	90_G	0.730	0.50
139_I	145_C	0.726	0.50
86_L	132_P	0.722	0.49
99_L	102_L	0.718	0.49
58_L	85_K	0.712	0.48
40_L	47_A	0.709	0.48
47_A	82_L	0.703	0.47
106_K	113_A	0.703	0.47
62_A	80_C	0.701	0.47
38_I	120_E	0.701	0.47
90_G	95_Y	0.700	0.47
70_K	111_I	0.685	0.46
41_D	78_G	0.685	0.46
28_V	32_G	0.684	0.46
20_S	31_L	0.681	0.45
45_K	61_E	0.679	0.45
58_L	131_P	0.673	0.45
50_E	123_E	0.668	0.44
90_G	93_K	0.667	0.44
38_I	81_K	0.667	0.44
4_L	7_L	0.662	0.44
19_L	76_D	0.661	0.43
55_K	90_G	0.659	0.43
130_Y	137_Y	0.658	0.43
3_L	15_K	0.657	0.43
42_K	91_H	0.656	0.43
55_K	123_E	0.649	0.42
99_L	104_P	0.649	0.42
73_G	124_F	0.645	0.42
76_D	117_K	0.643	0.42
59_F	64_V	0.642	0.42
21_M	27_L	0.637	0.41
21_M	45_K	0.636	0.41
99_L	119_G	0.633	0.41
39_V	84_I	0.631	0.41
16_I	22_I	0.630	0.41
28_V	34_V	0.629	0.40
32_G	64_V	0.626	0.40
45_K	75_F	0.622	0.40
10_L	14_K	0.621	0.40
5_I	10_L	0.621	0.40
21_M	38_I	0.620	0.40
25_S	127_I	0.616	0.39
39_V	43_Y	0.613	0.39
132_P	138_N	0.612	0.39
52_L	106_K	0.608	0.38
57_L	64_V	0.602	0.38
69_I	122_K	0.599	0.38
59_F	80_C	0.599	0.38
108_K	127_I	0.599	0.38
35_F	38_I	0.594	0.37
38_I	42_K	0.592	0.37
86_L	89_K	0.590	0.37
48_K	76_D	0.589	0.37
14_K	19_L	0.588	0.37
41_D	106_K	0.582	0.36
9_I	17_L	0.580	0.36
69_I	113_A	0.574	0.35
50_E	80_C	0.570	0.35
45_K	130_Y	0.570	0.35
32_G	53_S	0.567	0.35
18_A	82_L	0.566	0.35
109_S	132_P	0.563	0.34
70_K	86_L	0.562	0.34
29_L	62_A	0.562	0.34
11_L	21_M	0.562	0.34
121_S	141_L	0.554	0.34
49_L	87_V	0.550	0.33
79_K	113_A	0.544	0.33
120_E	141_L	0.541	0.33
91_H	97_N	0.539	0.32
67_G	116_L	0.538	0.32
8_A	22_I	0.537	0.32
64_V	68_T	0.535	0.32
53_S	93_K	0.534	0.32
5_I	26_F	0.527	0.31
32_G	108_K	0.522	0.31
19_L	28_V	0.521	0.31
58_L	144_E	0.521	0.31
63_I	69_I	0.521	0.31
106_K	132_P	0.520	0.31
77_I	143_A	0.519	0.31
26_F	54_Q	0.518	0.31
3_L	27_L	0.517	0.31
63_I	139_I	0.516	0.30
53_S	64_V	0.516	0.30
45_K	131_P	0.516	0.30
88_N	131_P	0.515	0.30
45_K	49_L	0.512	0.30
96_K	101_K	0.512	0.30
43_Y	87_V	0.511	0.30
49_L	122_K	0.510	0.30
85_K	133_Y	0.509	0.30
2_I	8_A	0.509	0.30
137_Y	143_A	0.502	0.29
62_A	145_C	0.500	0.29
69_I	131_P	0.500	0.29

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2x3cA	2	0.6301	73.9	0.878	Contact Map
2l0dA	1	0.5959	62.3	0.887	Contact Map
3isyA	1	0.6507	56.2	0.891	Contact Map
3iduA	1	0.6644	45.6	0.898	Contact Map
3cfuA	1	0.7671	44.8	0.898	Contact Map
1yewA	3	0.9589	42.1	0.9	Contact Map
4r4gA	1	0.6849	34.9	0.904	Contact Map
3abzA	3	0.7808	24.4	0.912	Contact Map
2kutA	1	0.6096	23.7	0.912	Contact Map
4phzA	3	0.9384	22.3	0.913	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0061 seconds.