Cas_GSU0053 - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Cas_GSU0053 - CRISPR-associated protein GSU0053 (Cas_GSU0053)

PFAM:	PF09617	Sequences: LLLRAELQPVGGPGDRFFPPTFPDLGAATYAIETRRGPDGTRVVLVDSVQSQANRLEPALWDAAYDDGVLALPYVRVDFDGEGLTSSLEAPHRLADAYIRDSELDGKPFRKSELGKALKAAVDPRNAAALFKLDPTSLLFGVWDSRPLGGGGAKLPRALSSEIEAVDVR	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	169 (167)
Sequences:	2358 (1699)
Seq/√Len:	131.5
META:	0.925

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
52_Q	161_S	4.554	1.00
61_W	89_E	3.884	1.00
17_F	46_V	3.559	1.00
11_G	15_D	3.184	1.00
73_P	135_P	2.827	1.00
31_A	42_R	2.651	1.00
34_T	42_R	2.375	1.00
115_G	118_L	2.302	1.00
137_S	142_V	2.281	1.00
76_R	84_L	2.214	1.00
25_L	28_A	2.146	1.00
22_F	48_S	2.103	1.00
117_A	132_K	2.068	1.00
107_K	111_K	2.062	1.00
86_S	89_E	2.024	1.00
56_L	159_L	1.954	1.00
94_L	130_L	1.927	1.00
85_T	90_A	1.915	1.00
95_A	142_V	1.880	1.00
58_P	89_E	1.864	1.00
43_V	166_V	1.835	1.00
90_A	98_Y	1.816	1.00
145_S	149_G	1.815	1.00
74_Y	86_S	1.804	1.00
97_A	146_R	1.795	1.00
20_P	46_V	1.769	1.00
134_D	137_S	1.731	1.00
75_V	94_L	1.729	1.00
45_L	48_S	1.678	1.00
47_D	52_Q	1.670	1.00
51_S	55_R	1.650	1.00
37_G	41_T	1.645	1.00
115_G	119_K	1.629	1.00
100_R	146_R	1.620	1.00
78_D	84_L	1.617	1.00
83_G	86_S	1.572	1.00
56_L	140_F	1.559	1.00
68_G	88_L	1.542	1.00
83_G	89_E	1.529	1.00
64_A	74_Y	1.479	1.00
116_K	120_A	1.472	1.00
77_V	99_I	1.465	1.00
66_D	84_L	1.462	1.00
41_T	167_D	1.449	1.00
61_W	66_D	1.443	1.00
100_R	145_S	1.433	1.00
67_D	71_A	1.429	1.00
24_D	27_A	1.425	1.00
108_P	111_K	1.388	1.00
112_S	115_G	1.359	1.00
54_N	57_E	1.344	1.00
65_Y	68_G	1.341	1.00
97_A	100_R	1.329	1.00
113_E	116_K	1.328	1.00
131_F	138_L	1.302	1.00
24_D	28_A	1.299	1.00
47_D	51_S	1.257	1.00
78_D	82_E	1.255	1.00
26_G	29_T	1.243	1.00
68_G	71_A	1.236	1.00
138_L	155_L	1.230	1.00
8_Q	14_G	1.224	1.00
68_G	72_L	1.192	0.99
111_K	118_L	1.191	0.99
29_T	42_R	1.159	0.99
116_K	119_K	1.148	0.99
30_Y	33_E	1.142	0.99
138_L	158_A	1.133	0.99
34_T	40_G	1.131	0.99
87_S	134_D	1.127	0.99
117_A	120_A	1.123	0.99
42_R	167_D	1.123	0.99
121_A	155_L	1.121	0.99
165_A	168_V	1.115	0.99
149_G	152_G	1.107	0.99
22_F	45_L	1.106	0.99
114_L	133_L	1.097	0.99
66_D	76_R	1.083	0.99
47_D	55_R	1.042	0.99
44_V	165_A	1.041	0.99
94_L	142_V	1.040	0.98
101_D	145_S	1.039	0.98
101_D	146_R	1.038	0.98
148_L	153_A	1.027	0.98
115_G	150_G	1.023	0.98
97_A	101_D	1.010	0.98
58_P	69_V	1.008	0.98
36_R	40_G	1.007	0.98
126_N	129_A	0.994	0.98
113_E	118_L	0.988	0.98
104_L	109_F	0.968	0.98
87_S	99_I	0.959	0.97
44_V	168_V	0.956	0.97
107_K	113_E	0.943	0.97
130_L	142_V	0.941	0.97
72_L	87_S	0.938	0.97
147_P	150_G	0.936	0.97
115_G	121_A	0.923	0.97
60_L	70_L	0.916	0.97
157_R	161_S	0.910	0.96
75_V	99_I	0.906	0.96
118_L	121_A	0.904	0.96
7_L	163_I	0.903	0.96
124_P	127_A	0.895	0.96
110_R	115_G	0.893	0.96
52_Q	55_R	0.893	0.96
114_L	117_A	0.876	0.96
6_E	13_P	0.873	0.96
142_V	156_P	0.871	0.96
103_E	107_K	0.855	0.95
68_G	74_Y	0.851	0.95
105_D	108_P	0.850	0.95
18_F	21_T	0.827	0.94
111_K	115_G	0.819	0.94
45_L	50_Q	0.817	0.94
88_L	136_T	0.809	0.93
95_A	137_S	0.788	0.92
56_L	59_A	0.788	0.92
103_E	106_G	0.778	0.92
100_R	152_G	0.777	0.92
33_E	36_R	0.775	0.92
136_T	140_F	0.770	0.92
123_D	126_N	0.769	0.92
151_G	154_K	0.768	0.91
155_L	158_A	0.767	0.91
127_A	155_L	0.766	0.91
106_G	110_R	0.764	0.91
48_S	51_S	0.763	0.91
8_Q	13_P	0.762	0.91
135_P	144_D	0.760	0.91
64_A	72_L	0.757	0.91
18_F	90_A	0.752	0.91
50_Q	162_E	0.749	0.90
128_A	145_S	0.747	0.90
139_L	159_L	0.747	0.90
41_T	166_V	0.746	0.90
35_R	39_D	0.745	0.90
127_A	153_A	0.744	0.90
78_D	83_G	0.741	0.90
100_R	149_G	0.739	0.90
27_A	168_V	0.733	0.89
129_A	158_A	0.726	0.89
113_E	120_A	0.721	0.89
121_A	127_A	0.721	0.89
145_S	150_G	0.717	0.88
144_D	148_L	0.716	0.88
59_A	71_A	0.716	0.88
45_L	56_L	0.715	0.88
101_D	150_G	0.711	0.88
12_G	15_D	0.710	0.88
63_A	66_D	0.697	0.87
65_Y	71_A	0.695	0.87
118_L	142_V	0.695	0.87
34_T	62_D	0.694	0.87
95_A	152_G	0.693	0.87
55_R	58_P	0.691	0.87
46_V	165_A	0.689	0.86
15_D	43_V	0.688	0.86
115_G	120_A	0.685	0.86
47_D	143_W	0.671	0.85
106_G	109_F	0.669	0.85
100_R	153_A	0.659	0.84
111_K	116_K	0.652	0.83
160_S	165_A	0.651	0.83
80_D	83_G	0.649	0.83
95_A	144_D	0.648	0.83
22_F	28_A	0.646	0.83
79_F	84_L	0.642	0.82
3_L	56_L	0.641	0.82
49_V	160_S	0.641	0.82
69_V	72_L	0.641	0.82
36_R	39_D	0.640	0.82
88_L	127_A	0.639	0.82
113_E	117_A	0.633	0.81
112_S	116_K	0.631	0.81
120_A	126_N	0.628	0.81
34_T	39_D	0.628	0.81
161_S	166_V	0.621	0.80
117_A	126_N	0.621	0.80
102_S	106_G	0.618	0.80
65_Y	104_L	0.615	0.79
149_G	154_K	0.615	0.79
144_D	147_P	0.615	0.79
15_D	30_Y	0.613	0.79
95_A	134_D	0.607	0.79
125_R	129_A	0.606	0.78
20_P	47_D	0.605	0.78
51_S	54_N	0.604	0.78
4_R	14_G	0.602	0.78
104_L	112_S	0.601	0.78
90_A	99_I	0.598	0.78
53_A	157_R	0.596	0.77
43_V	156_P	0.592	0.77
106_G	112_S	0.589	0.77
2_L	14_G	0.589	0.77
75_V	142_V	0.580	0.75
117_A	129_A	0.574	0.75
103_E	112_S	0.573	0.75
113_E	132_K	0.569	0.74
76_R	88_L	0.568	0.74
79_F	82_E	0.568	0.74
10_V	58_P	0.568	0.74
2_L	10_V	0.563	0.73
16_R	33_E	0.563	0.73
66_D	69_V	0.561	0.73
2_L	158_A	0.561	0.73
97_A	145_S	0.560	0.73
13_P	28_A	0.560	0.73
42_R	169_R	0.557	0.72
74_Y	134_D	0.555	0.72
90_A	94_L	0.555	0.72
67_D	76_R	0.554	0.72
49_V	157_R	0.553	0.72
142_V	155_L	0.547	0.71
32_I	42_R	0.536	0.70
19_P	27_A	0.536	0.70
128_A	132_K	0.535	0.69
30_Y	43_V	0.528	0.68
74_Y	137_S	0.527	0.68
85_T	98_Y	0.527	0.68
52_Q	96_D	0.526	0.68
129_A	132_K	0.525	0.68
119_K	147_P	0.525	0.68
62_D	65_Y	0.524	0.68
77_V	146_R	0.523	0.68
68_G	76_R	0.522	0.68
107_K	110_R	0.521	0.67
7_L	83_G	0.520	0.67
23_P	26_G	0.518	0.67
146_R	149_G	0.518	0.67
45_L	162_E	0.518	0.67
102_S	145_S	0.517	0.67
87_S	136_T	0.517	0.67
162_E	166_V	0.516	0.67
65_Y	69_V	0.514	0.66
96_D	143_W	0.512	0.66
64_A	76_R	0.511	0.66
91_P	98_Y	0.510	0.66
111_K	120_A	0.509	0.66
33_E	50_Q	0.507	0.65
23_P	29_T	0.506	0.65
95_A	155_L	0.505	0.65
20_P	27_A	0.505	0.65
130_L	155_L	0.504	0.65
31_A	48_S	0.502	0.65
77_V	85_T	0.501	0.64
94_L	137_S	0.501	0.64
147_P	152_G	0.501	0.64
114_L	118_L	0.500	0.64
102_S	105_D	0.500	0.64

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2irmA	1	0.4675	3.9	0.959	Contact Map
2mpvA	1	0.6036	3.8	0.959	Contact Map
1bh9A	1	0.2367	3	0.962	Contact Map
2g48C	1	0.1183	2.9	0.962	Contact Map
1zzaA	1	0.3195	2.8	0.962	Contact Map
2k5jA	2	0.4734	2.4	0.964	Contact Map
3t91A	3	0.355	2.1	0.965	Contact Map
2isnA	2	0.3905	1.9	0.965	Contact Map
1vsy3	1	0.3314	1.8	0.966	Contact Map
1d3bB	1	0.213	1.8	0.966	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0066 seconds.