Spore_III_AF - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Spore_III_AF - Stage III sporulation protein AF (Spore_III_AF)

PFAM:	PF09581	Sequences: ILIVLLATFLEMLLPNGSMKKYVKLVLGLLLILAILSPILKLLNKDFDLELAAESESSEPELEEIEEEGEELKEEQQEQILEQYEEQLEKQIKELLEEEGYEVADVEVEIEEDEESDFGEIKKVEVTLKEEEEEEEEEEKEVEPVEPVEIGDTGEEEEEEEEEESEEEEEIKELLSEFYGISEEKIEVQ	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	189 (184)
Sequences:	1521 (1374)
Seq/√Len:	101.3
META:	0.63

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
123_K	187_E	4.103	1.00
3_I	34_A	3.880	1.00
96_L	171_I	3.331	1.00
143_E	146_E	3.186	1.00
3_I	31_L	2.981	1.00
107_E	125_E	2.885	1.00
82_E	86_E	2.838	1.00
125_E	187_E	2.731	1.00
68_E	71_E	2.592	1.00
89_E	108_V	2.408	1.00
103_V	106_V	2.263	1.00
173_E	183_E	2.246	1.00
69_G	72_L	2.171	1.00
76_Q	79_Q	2.160	1.00
81_L	85_E	2.131	1.00
86_E	89_E	2.122	1.00
91_Q	179_Y	2.107	1.00
92_I	175_L	2.096	1.00
172_K	176_S	2.078	1.00
109_E	123_K	2.010	1.00
75_E	78_E	1.946	1.00
91_Q	95_L	1.937	1.00
72_L	76_Q	1.824	1.00
16_N	20_K	1.823	1.00
82_E	85_E	1.822	1.00
14_L	23_V	1.815	1.00
74_E	77_Q	1.694	1.00
84_Y	119_G	1.692	1.00
12_M	15_P	1.667	1.00
20_K	24_K	1.651	1.00
72_L	79_Q	1.648	1.00
167_E	170_E	1.610	1.00
66_E	70_E	1.595	1.00
145_V	148_V	1.588	1.00
17_G	20_K	1.554	1.00
90_K	93_K	1.536	1.00
102_E	129_K	1.529	1.00
105_D	127_T	1.509	1.00
142_V	145_V	1.503	1.00
97_E	103_V	1.496	1.00
166_E	170_E	1.469	1.00
92_I	124_V	1.463	1.00
32_I	40_L	1.458	1.00
182_S	185_K	1.436	1.00
3_I	11_E	1.408	1.00
99_E	170_E	1.399	1.00
28_G	32_I	1.389	1.00
172_K	183_E	1.364	0.99
25_L	30_L	1.363	0.99
92_I	96_L	1.356	0.99
93_K	97_E	1.355	0.99
128_L	171_I	1.346	0.99
94_E	97_E	1.344	0.99
111_E	122_K	1.343	0.99
70_E	73_K	1.342	0.99
31_L	96_L	1.334	0.99
181_I	185_K	1.329	0.99
156_E	159_E	1.321	0.99
65_I	69_G	1.308	0.99
10_L	27_L	1.295	0.99
101_Y	167_E	1.285	0.99
9_F	12_M	1.275	0.99
74_E	78_E	1.263	0.99
83_Q	92_I	1.255	0.99
96_L	101_Y	1.251	0.99
95_L	174_L	1.250	0.99
71_E	75_E	1.233	0.99
66_E	69_G	1.229	0.99
31_L	34_A	1.216	0.99
145_V	150_I	1.193	0.99
63_E	66_E	1.188	0.98
126_V	175_L	1.165	0.98
169_E	173_E	1.165	0.98
109_E	125_E	1.150	0.98
3_I	10_L	1.147	0.98
95_L	178_F	1.135	0.98
83_Q	87_Q	1.132	0.98
109_E	122_K	1.131	0.98
10_L	22_Y	1.115	0.98
153_T	157_E	1.115	0.98
7_A	12_M	1.096	0.97
64_E	68_E	1.094	0.97
93_K	124_V	1.076	0.97
73_K	76_Q	1.075	0.97
39_I	136_E	1.074	0.97
7_A	11_E	1.063	0.97
169_E	183_E	1.045	0.97
79_Q	96_L	1.043	0.97
60_P	63_E	1.043	0.97
72_L	75_E	1.042	0.97
69_G	79_Q	1.036	0.96
168_E	172_K	1.036	0.96
30_L	34_A	1.036	0.96
87_Q	90_K	1.023	0.96
175_L	186_I	1.023	0.96
47_F	88_L	1.007	0.96
12_M	26_V	1.003	0.96
119_G	179_Y	0.998	0.96
117_D	120_E	0.994	0.95
153_T	156_E	0.987	0.95
46_D	179_Y	0.983	0.95
180_G	185_K	0.969	0.95
84_Y	179_Y	0.966	0.95
47_F	50_E	0.948	0.94
4_V	16_N	0.939	0.94
69_G	73_K	0.931	0.94
80_I	83_Q	0.928	0.93
4_V	31_L	0.925	0.93
108_V	112_E	0.920	0.93
169_E	172_K	0.920	0.93
88_L	171_I	0.918	0.93
176_S	182_S	0.917	0.93
7_A	31_L	0.909	0.93
11_E	15_P	0.902	0.92
137_E	144_P	0.897	0.92
85_E	179_Y	0.887	0.92
90_K	94_E	0.877	0.91
13_L	83_Q	0.871	0.91
30_L	99_E	0.869	0.91
39_I	43_L	0.867	0.91
56_E	59_E	0.862	0.91
85_E	112_E	0.861	0.91
110_I	119_G	0.853	0.90
78_E	82_E	0.843	0.90
35_I	77_Q	0.843	0.90
10_L	21_K	0.833	0.89
25_L	84_Y	0.826	0.89
126_V	179_Y	0.822	0.89
12_M	19_M	0.820	0.88
73_K	77_Q	0.818	0.88
179_Y	188_V	0.818	0.88
24_K	180_G	0.812	0.88
5_L	21_K	0.810	0.88
59_E	69_G	0.808	0.88
136_E	139_E	0.799	0.87
4_V	12_M	0.786	0.86
78_E	81_L	0.782	0.86
97_E	145_V	0.781	0.86
7_A	27_L	0.780	0.86
10_L	101_Y	0.780	0.86
103_V	126_V	0.779	0.86
37_S	41_K	0.776	0.85
99_E	106_V	0.774	0.85
9_F	21_K	0.772	0.85
162_E	177_E	0.770	0.85
161_E	181_I	0.763	0.85
33_L	37_S	0.761	0.84
96_L	106_V	0.755	0.84
111_E	120_E	0.749	0.83
104_A	129_K	0.739	0.83
37_S	40_L	0.738	0.83
63_E	160_E	0.731	0.82
32_I	51_L	0.729	0.82
57_S	60_P	0.729	0.82
3_I	12_M	0.729	0.82
67_E	72_L	0.723	0.81
180_G	187_E	0.720	0.81
27_L	34_A	0.716	0.81
155_E	162_E	0.716	0.81
136_E	146_E	0.714	0.80
22_Y	97_E	0.711	0.80
11_E	14_L	0.704	0.79
11_E	34_A	0.701	0.79
2_L	177_E	0.698	0.79
6_L	176_S	0.698	0.79
154_G	157_E	0.696	0.79
2_L	29_L	0.696	0.79
30_L	180_G	0.695	0.79
32_I	84_Y	0.693	0.78
80_I	112_E	0.691	0.78
126_V	171_I	0.690	0.78
174_L	178_F	0.685	0.78
87_Q	96_L	0.678	0.77
12_M	33_L	0.678	0.77
178_F	181_I	0.673	0.76
139_E	142_V	0.671	0.76
84_Y	118_F	0.671	0.76
139_E	143_E	0.670	0.76
136_E	153_T	0.669	0.76
134_E	139_E	0.661	0.75
113_D	116_S	0.659	0.75
27_L	108_V	0.655	0.74
12_M	20_K	0.653	0.74
6_L	81_L	0.648	0.74
11_E	19_M	0.647	0.73
111_E	116_S	0.646	0.73
44_N	59_E	0.646	0.73
88_L	109_E	0.646	0.73
111_E	117_D	0.646	0.73
35_I	47_F	0.642	0.73
88_L	108_V	0.641	0.73
95_L	179_Y	0.641	0.73
168_E	188_V	0.631	0.72
9_F	30_L	0.631	0.72
12_M	147_P	0.628	0.71
4_V	87_Q	0.625	0.71
81_L	110_I	0.624	0.71
56_E	71_E	0.623	0.71
184_E	188_V	0.621	0.70
137_E	157_E	0.616	0.70
49_L	82_E	0.614	0.70
96_L	103_V	0.613	0.69
91_Q	178_F	0.609	0.69
11_E	24_K	0.608	0.69
66_E	92_I	0.607	0.69
9_F	181_I	0.605	0.68
68_E	72_L	0.603	0.68
22_Y	103_V	0.602	0.68
11_E	20_K	0.600	0.68
7_A	84_Y	0.594	0.67
161_E	183_E	0.594	0.67
134_E	155_E	0.592	0.67
92_I	106_V	0.591	0.67
7_A	16_N	0.589	0.66
5_L	113_D	0.588	0.66
3_I	30_L	0.586	0.66
64_E	74_E	0.586	0.66
111_E	114_E	0.584	0.66
22_Y	25_L	0.583	0.66
9_F	95_L	0.580	0.65
21_K	33_L	0.579	0.65
2_L	6_L	0.574	0.64
158_E	161_E	0.574	0.64
104_A	126_V	0.570	0.64
168_E	187_E	0.569	0.64
4_V	11_E	0.566	0.63
184_E	187_E	0.565	0.63
7_A	24_K	0.565	0.63
110_I	113_D	0.560	0.63
124_V	181_I	0.558	0.62
57_S	162_E	0.557	0.62
7_A	25_L	0.556	0.62
1_I	14_L	0.556	0.62
1_I	179_Y	0.555	0.62
40_L	46_D	0.553	0.62
89_E	93_K	0.551	0.61
96_L	126_V	0.550	0.61
18_S	102_E	0.550	0.61
14_L	30_L	0.550	0.61
171_I	188_V	0.550	0.61
9_F	175_L	0.549	0.61
31_L	35_I	0.547	0.61
12_M	27_L	0.547	0.61
3_I	9_F	0.547	0.61
13_L	29_L	0.545	0.60
143_E	157_E	0.538	0.59
85_E	92_I	0.538	0.59
130_E	155_E	0.537	0.59
5_L	179_Y	0.537	0.59
138_E	181_I	0.535	0.59
121_I	186_I	0.534	0.59
167_E	171_I	0.531	0.58
52_A	110_I	0.531	0.58
1_I	47_F	0.531	0.58
24_K	29_L	0.531	0.58
49_L	166_E	0.531	0.58
112_E	163_E	0.527	0.58
25_L	76_Q	0.527	0.58
109_E	112_E	0.526	0.58
17_G	87_Q	0.526	0.58
32_I	104_A	0.523	0.57
11_E	26_V	0.523	0.57
95_L	175_L	0.522	0.57
101_Y	130_E	0.522	0.57
9_F	29_L	0.520	0.57
160_E	170_E	0.516	0.56
10_L	180_G	0.516	0.56
68_E	90_K	0.515	0.56
83_Q	86_E	0.511	0.56
155_E	158_E	0.511	0.56
2_L	93_K	0.511	0.56
67_E	74_E	0.510	0.55
13_L	40_L	0.509	0.55
71_E	74_E	0.507	0.55
27_L	85_E	0.505	0.55
155_E	172_K	0.500	0.54

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
4bpeC	1	0.4603	18.5	0.918	Contact Map
1n91A	1	0.3862	18.2	0.918	Contact Map
4w23D	1	0.4603	14.2	0.922	Contact Map
4bpeP	1	0.291	10	0.927	Contact Map
3mb2B	3	0.2275	9.8	0.927	Contact Map
3zeyX	1	0.4444	9.2	0.928	Contact Map
4c00A	1	0.619	9.2	0.928	Contact Map
3r9jC	2	0.2751	8.8	0.929	Contact Map
2kxoA	2	0.3439	8.2	0.93	Contact Map
3j7aD	1	0.2593	8.2	0.93	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0066 seconds.