Spore_YunB - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Spore_YunB - Sporulation protein YunB (Spo_YunB)

PFAM:	PF09560	Sequences: KISIPLGQLTGSPLLAGLGPKIPVKIIPVGSVETDFKSEFESAGINQTRHRIYLEVEVEVRIIIPFASEEIEVSTEVPIAETVIVGDVPDT	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	91 (90)
Sequences:	2591 (1999)
Seq/√Len:	210.7
META:	0.811

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
37_K	55_E	3.627	1.00
39_E	51_R	3.443	1.00
57_E	72_E	3.410	1.00
55_E	74_S	3.021	1.00
55_E	76_E	2.890	1.00
57_E	74_S	2.739	1.00
59_E	72_E	2.597	1.00
3_S	21_K	2.235	1.00
37_K	76_E	2.075	1.00
59_E	70_E	1.998	1.00
41_E	49_R	1.960	1.00
35_D	55_E	1.942	1.00
53_Y	78_P	1.739	1.00
61_R	70_E	1.719	1.00
33_E	57_E	1.687	1.00
34_T	56_V	1.686	1.00
49_R	81_E	1.680	1.00
41_E	51_R	1.613	1.00
50_H	81_E	1.566	1.00
81_E	85_V	1.549	1.00
40_F	48_T	1.539	1.00
53_Y	76_E	1.513	1.00
43_A	48_T	1.505	1.00
78_P	81_E	1.474	1.00
40_F	81_E	1.443	1.00
40_F	50_H	1.332	1.00
38_S	53_Y	1.284	1.00
8_Q	16_A	1.283	1.00
82_T	85_V	1.279	1.00
61_R	68_S	1.255	1.00
37_K	53_Y	1.230	1.00
3_S	23_P	1.213	1.00
35_D	76_E	1.192	1.00
10_T	13_P	1.172	1.00
47_Q	85_V	1.107	1.00
7_G	19_G	1.051	1.00
38_S	52_I	1.049	1.00
87_D	90_D	1.038	1.00
49_R	83_V	1.025	1.00
48_T	85_V	1.016	1.00
54_L	79_I	1.014	1.00
38_S	50_H	0.982	1.00
43_A	85_V	0.977	1.00
51_R	81_E	0.975	1.00
43_A	81_E	0.971	1.00
44_G	47_Q	0.948	0.99
36_F	79_I	0.937	0.99
6_L	20_P	0.919	0.99
47_Q	50_H	0.913	0.99
35_D	57_E	0.872	0.99
47_Q	81_E	0.869	0.99
17_G	61_R	0.851	0.99
86_G	89_P	0.846	0.99
40_F	43_A	0.845	0.99
8_Q	18_L	0.834	0.99
8_Q	13_P	0.832	0.99
17_G	27_I	0.826	0.99
52_I	80_A	0.815	0.98
38_S	49_R	0.807	0.98
28_P	63_I	0.798	0.98
23_P	34_T	0.794	0.98
28_P	31_S	0.786	0.98
32_V	56_V	0.785	0.98
40_F	83_V	0.785	0.98
12_S	17_G	0.780	0.98
4_I	8_Q	0.778	0.98
43_A	52_I	0.775	0.98
40_F	47_Q	0.774	0.98
8_Q	11_G	0.773	0.98
10_T	15_L	0.766	0.98
7_G	10_T	0.757	0.98
15_L	18_L	0.750	0.97
38_S	51_R	0.733	0.97
50_H	80_A	0.731	0.97
39_E	76_E	0.720	0.97
54_L	68_S	0.719	0.97
17_G	25_K	0.715	0.97
25_K	69_E	0.706	0.96
54_L	62_I	0.698	0.96
8_Q	36_F	0.689	0.96
33_E	80_A	0.686	0.96
67_A	77_V	0.686	0.96
43_A	47_Q	0.675	0.95
30_G	52_I	0.671	0.95
10_T	19_G	0.661	0.95
58_V	75_T	0.661	0.95
28_P	32_V	0.654	0.94
39_E	53_Y	0.650	0.94
30_G	60_V	0.643	0.94
18_L	21_K	0.642	0.94
60_V	71_I	0.637	0.93
20_P	52_I	0.622	0.93
69_E	72_E	0.619	0.93
13_P	24_V	0.617	0.92
50_H	83_V	0.617	0.92
43_A	82_T	0.608	0.92
9_L	51_R	0.607	0.92
47_Q	83_V	0.603	0.92
43_A	50_H	0.601	0.91
33_E	59_E	0.597	0.91
60_V	65_P	0.593	0.91
6_L	21_K	0.586	0.90
27_I	63_I	0.584	0.90
9_L	22_I	0.582	0.90
43_A	49_R	0.580	0.90
16_A	29_V	0.579	0.90
23_P	27_I	0.579	0.90
67_A	79_I	0.578	0.90
56_V	77_V	0.578	0.90
28_P	64_I	0.577	0.90
10_T	18_L	0.569	0.89
36_F	77_V	0.567	0.89
28_P	40_F	0.565	0.89
23_P	28_P	0.565	0.89
13_P	36_F	0.563	0.89
38_S	82_T	0.561	0.88
63_I	68_S	0.560	0.88
16_A	19_G	0.558	0.88
25_K	36_F	0.548	0.87
62_I	69_E	0.546	0.87
32_V	58_V	0.546	0.87
28_P	62_I	0.544	0.87
36_F	39_E	0.544	0.87
9_L	78_P	0.535	0.86
4_I	75_T	0.531	0.85
21_K	59_E	0.521	0.84
50_H	82_T	0.518	0.84
7_G	45_I	0.515	0.84
26_I	68_S	0.514	0.84
40_F	82_T	0.512	0.83
66_F	69_E	0.511	0.83
26_I	64_I	0.510	0.83
50_H	85_V	0.509	0.83
62_I	71_I	0.503	0.82
13_P	69_E	0.500	0.82

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2y26A	8	0.5495	3.9	0.922	Contact Map
1ou8A	2	0.3297	2.4	0.93	Contact Map
4kq7A	4	0.7473	1.9	0.934	Contact Map
3napB	4	0.6923	1.7	0.935	Contact Map
2lr4A	1	0.3846	1.6	0.937	Contact Map
1wc3A	2	0.8791	1.3	0.939	Contact Map
4jk8A	1	0.9451	1.2	0.941	Contact Map
1a6cA	6	0.5385	1.1	0.942	Contact Map
3gd0A	1	0.8901	1.1	0.943	Contact Map
3ogzA	1	0.9011	1	0.943	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0053 seconds.