Phage_TAC_6 - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Phage_TAC_6 - Phage tail assembly chaperone protein, TAC

PFAM:	PF09550	Sequences: FPWPALMRAGLGVLGLSPDEFWALTPRELAAALGALAGGAAPLDRAELEALMARFPDE	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	58 (56)
Sequences:	3377 (2463)
Seq/√Len:	329.2
META:	0.886

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
17_S	20_E	4.151	1.00
16_L	24_L	3.673	1.00
44_D	47_E	2.859	1.00
19_D	23_A	2.670	1.00
47_E	50_A	2.535	1.00
7_M	11_L	2.486	1.00
43_L	48_L	1.804	1.00
9_A	13_V	1.749	1.00
14_L	32_A	1.739	1.00
24_L	32_A	1.578	1.00
49_E	52_M	1.534	1.00
10_G	29_L	1.515	1.00
2_P	5_A	1.466	1.00
9_A	33_L	1.371	1.00
50_A	54_R	1.306	1.00
6_L	29_L	1.254	1.00
48_L	52_M	1.243	1.00
45_R	49_E	1.228	1.00
43_L	47_E	1.179	1.00
3_W	28_E	1.158	1.00
50_A	53_A	1.137	1.00
46_A	49_E	1.118	1.00
12_G	32_A	1.090	1.00
7_M	31_A	1.068	1.00
25_T	29_L	1.064	1.00
26_P	29_L	1.053	1.00
49_E	53_A	1.023	1.00
30_A	34_G	0.974	1.00
10_G	16_L	0.944	1.00
51_L	55_F	0.943	1.00
22_W	28_E	0.915	1.00
4_P	8_R	0.847	1.00
26_P	30_A	0.841	1.00
8_R	12_G	0.839	1.00
8_R	34_G	0.805	1.00
8_R	13_V	0.798	1.00
34_G	39_G	0.790	1.00
4_P	34_G	0.759	1.00
6_L	21_F	0.755	0.99
40_A	46_A	0.753	0.99
16_L	25_T	0.753	0.99
2_P	6_L	0.752	0.99
18_P	24_L	0.746	0.99
47_E	54_R	0.732	0.99
25_T	30_A	0.721	0.99
45_R	52_M	0.721	0.99
35_A	38_G	0.720	0.99
8_R	36_L	0.715	0.99
10_G	14_L	0.713	0.99
15_G	36_L	0.713	0.99
5_A	8_R	0.705	0.99
30_A	33_L	0.698	0.99
27_R	31_A	0.694	0.99
11_L	15_G	0.680	0.99
3_W	6_L	0.646	0.98
44_D	52_M	0.642	0.98
2_P	31_A	0.633	0.98
24_L	29_L	0.625	0.98
21_F	29_L	0.618	0.98
47_E	51_L	0.617	0.98
35_A	39_G	0.603	0.98
22_W	26_P	0.601	0.97
12_G	31_A	0.600	0.97
31_A	34_G	0.598	0.97
9_A	12_G	0.595	0.97
11_L	16_L	0.589	0.97
11_L	18_P	0.580	0.97
11_L	17_S	0.572	0.97
6_L	30_A	0.566	0.96
7_M	10_G	0.550	0.96
47_E	52_M	0.550	0.96
5_A	12_G	0.538	0.95
36_L	41_A	0.530	0.95
12_G	52_M	0.530	0.95
13_V	55_F	0.527	0.95
17_S	24_L	0.526	0.95
27_R	30_A	0.523	0.94
34_G	45_R	0.521	0.94
21_F	47_E	0.517	0.94
19_D	41_A	0.511	0.94
32_A	36_L	0.508	0.94
2_P	26_P	0.503	0.93
43_L	46_A	0.502	0.93
45_R	48_L	0.500	0.93

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3qyhB	1	0.931	19.9	0.839	Contact Map
4zgjB	2	0.9483	13.2	0.852	Contact Map
1j3bA	2	0.8621	13.2	0.852	Contact Map
3hhtB	2	0.9483	12.8	0.853	Contact Map
4muoA	2	0.6034	10.6	0.858	Contact Map
3thgA	2	0.6034	10.5	0.858	Contact Map
4ob0B	1	0.9483	8.7	0.863	Contact Map
2guzB	1	0.6034	8.7	0.863	Contact Map
1iv8A	1	0.9138	8.1	0.865	Contact Map
3u52A	2	1	8.1	0.865	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0048 seconds.