ATPase_gene1 - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

ATPase_gene1 - Putative F0F1-ATPase subunit Ca2+/Mg2+ transporter

PFAM:	PF09527	Sequences: LGRASGLGLELVAAILLGALLGYWLDRWLGTSPWFTLVGLLLGVAAGFYNVYRQ	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	54 (51)
Sequences:	45040 (25878)
Seq/√Len:	3623.6
META:	0.958

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
20_L	24_W	2.622	1.00
24_W	28_W	2.574	1.00
24_W	27_R	2.417	1.00
20_L	23_Y	2.180	1.00
10_E	50_N	2.065	1.00
25_L	35_F	1.995	1.00
19_A	23_Y	1.778	1.00
19_A	36_T	1.677	1.00
23_Y	27_R	1.611	1.00
31_T	35_F	1.554	1.00
34_W	38_V	1.536	1.00
26_D	31_T	1.533	1.00
48_F	52_Y	1.422	1.00
29_L	35_F	1.375	1.00
6_G	10_E	1.263	1.00
45_A	49_Y	1.205	1.00
5_S	8_G	1.196	1.00
9_L	13_A	1.177	1.00
18_G	39_G	1.142	1.00
16_L	20_L	1.125	1.00
25_L	29_L	1.064	1.00
3_R	6_G	1.045	1.00
49_Y	53_R	1.031	1.00
5_S	9_L	1.031	1.00
19_A	40_L	1.026	1.00
14_A	18_G	1.018	1.00
21_L	39_G	1.011	1.00
25_L	39_G	1.003	1.00
22_G	26_D	0.998	1.00
43_G	47_G	0.987	1.00
35_F	39_G	0.968	1.00
14_A	50_N	0.966	1.00
26_D	35_F	0.958	1.00
42_L	46_A	0.891	1.00
40_L	44_V	0.890	1.00
14_A	46_A	0.884	1.00
23_Y	32_S	0.834	1.00
21_L	24_W	0.832	1.00
6_G	9_L	0.829	1.00
44_V	48_F	0.809	1.00
26_D	33_P	0.806	1.00
37_L	41_L	0.801	1.00
32_S	36_T	0.784	1.00
18_G	43_G	0.756	1.00
38_V	42_L	0.756	1.00
33_P	37_L	0.749	1.00
48_F	51_V	0.743	1.00
33_P	36_T	0.742	1.00
50_N	53_R	0.735	1.00
4_A	10_E	0.730	1.00
7_L	51_V	0.728	1.00
16_L	23_Y	0.705	1.00
26_D	36_T	0.693	1.00
21_L	25_L	0.683	1.00
46_A	50_N	0.677	1.00
41_L	45_A	0.673	1.00
35_F	38_V	0.666	1.00
47_G	50_N	0.660	1.00
25_L	28_W	0.659	1.00
10_E	14_A	0.654	1.00
46_A	49_Y	0.652	1.00
17_L	20_L	0.631	1.00
11_L	51_V	0.623	1.00
13_A	17_L	0.612	1.00
12_V	16_L	0.600	1.00
11_L	47_G	0.597	1.00
37_L	40_L	0.576	1.00
17_L	21_L	0.572	1.00
33_P	38_V	0.564	1.00
18_G	47_G	0.545	1.00
23_Y	36_T	0.538	1.00
14_A	43_G	0.527	1.00
26_D	32_S	0.515	1.00
14_A	17_L	0.513	1.00
8_G	15_I	0.512	1.00
15_I	19_A	0.500	1.00

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
4tphA	2	1	11.8	0.786	Contact Map
4xnjA	1	1	9.3	0.797	Contact Map
4uvmA	1	1	8.4	0.801	Contact Map
4ikvA	1	0.9815	7.4	0.806	Contact Map
4m64A	1	1	6.1	0.812	Contact Map
4oh3A	2	1	5.6	0.816	Contact Map
2kv5A	1	0.5556	5.6	0.816	Contact Map
4q65A	1	1	4.8	0.821	Contact Map
4w6vA	1	1	4.6	0.824	Contact Map
2cfqA	1	0.9815	3.9	0.83	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0041 seconds.