CbtB - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

CbtB - Probable cobalt transporter subunit (CbtB)

PFAM:	PF09489	Sequences: TTASASSRLLWALFAALLGLFLLYFVGFAQGAAVHEAAHDGRHALGFPCH	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	50 (46)
Sequences:	4589 (2202)
Seq/√Len:	324.7
META:	0.886

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
27_G	47_F	3.264	1.00
41_G	45_L	3.246	1.00
5_A	8_R	2.551	1.00
21_F	25_F	2.234	1.00
32_A	36_E	1.966	1.00
8_R	12_A	1.943	1.00
7_S	11_W	1.718	1.00
16_A	19_G	1.641	1.00
19_G	22_L	1.543	1.00
6_S	9_L	1.513	1.00
7_S	10_L	1.446	1.00
41_G	44_A	1.440	1.00
12_A	16_A	1.347	1.00
31_G	34_V	1.281	1.00
34_V	38_A	1.237	1.00
10_L	13_L	1.200	1.00
23_L	27_G	1.137	1.00
31_G	36_E	1.023	1.00
5_A	9_L	1.013	1.00
28_F	33_A	0.990	1.00
18_L	22_L	0.981	1.00
24_Y	29_A	0.980	1.00
25_F	28_F	0.925	1.00
16_A	20_L	0.899	1.00
29_A	34_V	0.891	1.00
20_L	24_Y	0.872	1.00
15_A	19_G	0.862	1.00
28_F	44_A	0.860	1.00
13_L	17_L	0.857	1.00
21_F	24_Y	0.853	1.00
10_L	14_F	0.843	1.00
8_R	11_W	0.827	1.00
36_E	46_G	0.824	1.00
41_G	46_G	0.823	1.00
30_Q	33_A	0.807	1.00
29_A	32_A	0.805	1.00
12_A	41_G	0.790	1.00
23_L	28_F	0.786	1.00
18_L	25_F	0.776	1.00
24_Y	31_G	0.771	1.00
40_D	48_P	0.736	0.99
6_S	10_L	0.730	0.99
40_D	47_F	0.721	0.99
39_H	43_H	0.718	0.99
9_L	13_L	0.715	0.99
26_V	47_F	0.701	0.99
6_S	24_Y	0.694	0.99
38_A	41_G	0.688	0.99
35_H	40_D	0.684	0.99
38_A	47_F	0.681	0.99
15_A	33_A	0.673	0.99
23_L	38_A	0.671	0.99
29_A	33_A	0.671	0.99
5_A	11_W	0.661	0.99
24_Y	47_F	0.654	0.98
31_G	45_L	0.651	0.98
11_W	15_A	0.650	0.98
44_A	47_F	0.589	0.97
38_A	44_A	0.581	0.97
12_A	15_A	0.559	0.96
17_L	20_L	0.559	0.96
43_H	50_H	0.548	0.96
37_A	41_G	0.544	0.95
27_G	40_D	0.539	0.95
36_E	40_D	0.539	0.95
20_L	27_G	0.538	0.95
6_S	34_V	0.530	0.95
6_S	17_L	0.513	0.94
38_A	46_G	0.500	0.93

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
1ywhA	4	0	2.9	0.874	Contact Map
1kzqA	2	0.06	2.5	0.879	Contact Map
2w61A	1	0	2.2	0.883	Contact Map
4wl1A	3	0.08	1.8	0.888	Contact Map
2m8rA	1	0.62	1.6	0.891	Contact Map
3ujzA	2	0.98	1.3	0.896	Contact Map
2wdqD	2	0.52	1.2	0.899	Contact Map
2g7hA	1	0.98	1.2	0.899	Contact Map
3fymA	1	0	1.1	0.9	Contact Map
2j7aC	2	0.66	1.1	0.901	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0039 seconds.