UTP15_C - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

UTP15_C - UTP15 C terminal

PFAM:	PF09384	Sequences: DYKGEGADIVVEGKPKKKKLKKYDKLLRKFRYSKALDAVLDPVKTKNPEVVVAVLEELRHRGALRAALAGRDEESLEPLLRFLIKHITDPRFTRLLVDVANVVLDLYSEVLGQSPELDELFRRLRRKVREEVELQQELLELQGMLDML	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	148 (143)
Sequences:	615 (478)
Seq/√Len:	40.0
META:	0.275

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
32_Y	63_A	4.592	1.00
31_R	34_K	4.585	1.00
37_D	71_R	4.534	1.00
112_G	118_D	4.219	1.00
52_V	82_F	3.490	1.00
83_L	124_L	3.193	1.00
100_A	124_L	3.134	1.00
20_L	28_R	2.687	1.00
48_P	86_H	2.645	1.00
71_R	107_Y	2.638	1.00
68_L	79_L	2.571	1.00
68_L	99_V	2.556	1.00
39_V	60_H	2.322	1.00
82_F	96_L	2.118	0.99
33_S	70_G	2.066	0.99
72_D	75_S	2.059	0.99
48_P	92_F	1.996	0.99
52_V	96_L	1.977	0.99
135_Q	138_L	1.921	0.99
103_V	121_F	1.895	0.98
71_R	78_P	1.894	0.98
55_L	99_V	1.848	0.98
59_R	98_D	1.843	0.98
40_L	79_L	1.812	0.98
26_L	38_A	1.748	0.97
99_V	107_Y	1.697	0.97
73_E	114_S	1.654	0.96
93_T	97_V	1.556	0.95
113_Q	118_D	1.521	0.94
32_Y	67_A	1.497	0.93
43_V	51_V	1.486	0.93
84_I	120_L	1.482	0.93
75_S	133_E	1.424	0.92
57_E	61_R	1.360	0.90
22_K	38_A	1.348	0.89
30_F	57_E	1.325	0.88
32_Y	61_R	1.308	0.88
56_E	98_D	1.304	0.87
84_I	146_D	1.285	0.87
4_G	11_V	1.281	0.87
37_D	78_P	1.274	0.86
71_R	121_F	1.267	0.86
39_V	50_V	1.253	0.85
72_D	114_S	1.239	0.85
77_E	117_L	1.193	0.82
51_V	74_E	1.167	0.81
58_L	64_L	1.147	0.80
23_Y	30_F	1.131	0.79
106_L	110_V	1.128	0.79
46_K	86_H	1.125	0.78
16_K	19_K	1.116	0.78
80_L	117_L	1.093	0.76
28_R	110_V	1.091	0.76
81_R	84_I	1.054	0.74
52_V	92_F	1.049	0.73
128_V	141_L	1.037	0.72
16_K	22_K	1.031	0.72
117_L	120_L	1.026	0.72
94_R	120_L	0.989	0.69
79_L	147_M	0.976	0.68
23_Y	26_L	0.973	0.68
10_V	16_K	0.969	0.67
5_E	13_G	0.963	0.67
54_V	148_L	0.945	0.65
68_L	107_Y	0.940	0.65
132_V	135_Q	0.932	0.64
26_L	31_R	0.930	0.64
64_L	108_S	0.926	0.64
8_D	28_R	0.925	0.64
137_E	145_L	0.922	0.63
113_Q	117_L	0.920	0.63
39_V	119_E	0.917	0.63
24_D	30_F	0.898	0.61
47_N	51_V	0.892	0.61
59_R	144_M	0.889	0.60
73_E	116_E	0.880	0.60
111_L	132_V	0.872	0.59
33_S	65_R	0.862	0.58
52_V	95_L	0.846	0.57
34_K	132_V	0.845	0.57
29_K	86_H	0.841	0.56
58_L	110_V	0.841	0.56
64_L	68_L	0.825	0.55
107_Y	112_G	0.824	0.55
53_A	91_R	0.823	0.55
64_L	99_V	0.819	0.54
53_A	82_F	0.807	0.53
34_K	74_E	0.804	0.53
85_K	94_R	0.802	0.53
91_R	100_A	0.797	0.52
27_L	61_R	0.792	0.52
37_D	68_L	0.786	0.51
29_K	137_E	0.783	0.51
4_G	147_M	0.775	0.50
103_V	139_L	0.775	0.50
81_R	116_E	0.773	0.50
25_K	31_R	0.757	0.49
133_E	136_Q	0.757	0.49
37_D	79_L	0.754	0.48
137_E	140_E	0.753	0.48
60_H	98_D	0.748	0.48
10_V	14_K	0.748	0.48
103_V	145_L	0.731	0.46
83_L	103_V	0.730	0.46
76_L	120_L	0.728	0.46
134_L	144_M	0.724	0.45
50_V	134_L	0.722	0.45
89_D	142_Q	0.721	0.45
71_R	76_L	0.718	0.45
128_V	132_V	0.718	0.45
60_H	69_A	0.712	0.44
117_L	141_L	0.711	0.44
125_R	129_R	0.707	0.44
56_E	95_L	0.704	0.44
68_L	106_L	0.704	0.44
37_D	107_Y	0.703	0.44
49_E	111_L	0.694	0.43
10_V	127_K	0.690	0.42
84_I	124_L	0.689	0.42
76_L	103_V	0.686	0.42
56_E	60_H	0.685	0.42
53_A	62_G	0.683	0.42
25_K	29_K	0.683	0.42
144_M	148_L	0.682	0.42
80_L	124_L	0.679	0.41
22_K	119_E	0.679	0.41
71_R	89_D	0.678	0.41
23_Y	92_F	0.677	0.41
48_P	51_V	0.672	0.41
82_F	138_L	0.672	0.41
87_I	96_L	0.672	0.41
59_R	82_F	0.669	0.41
109_E	136_Q	0.668	0.40
45_T	85_K	0.667	0.40
141_L	146_D	0.666	0.40
31_R	56_E	0.664	0.40
77_E	119_E	0.658	0.40
49_E	53_A	0.655	0.39
72_D	107_Y	0.653	0.39
61_R	105_D	0.648	0.39
137_E	148_L	0.641	0.38
9_I	70_G	0.640	0.38
85_K	98_D	0.632	0.37
125_R	137_E	0.630	0.37
69_A	107_Y	0.629	0.37
95_L	100_A	0.628	0.37
62_G	98_D	0.624	0.37
102_V	147_M	0.618	0.36
95_L	128_V	0.618	0.36
39_V	57_E	0.616	0.36
29_K	94_R	0.616	0.36
73_E	118_D	0.615	0.36
21_K	31_R	0.606	0.35
78_P	107_Y	0.606	0.35
20_L	24_D	0.603	0.35
52_V	60_H	0.595	0.34
33_S	75_S	0.593	0.34
72_D	85_K	0.592	0.34
20_L	26_L	0.591	0.34
116_E	123_R	0.591	0.34
118_D	146_D	0.591	0.34
11_V	104_L	0.590	0.34
81_R	120_L	0.588	0.34
79_L	99_V	0.587	0.34
99_V	108_S	0.584	0.33
93_T	100_A	0.584	0.33
73_E	115_P	0.584	0.33
96_L	100_A	0.582	0.33
97_V	114_S	0.581	0.33
34_K	141_L	0.581	0.33
77_E	116_E	0.579	0.33
29_K	97_V	0.579	0.33
7_A	12_E	0.579	0.33
122_R	126_R	0.575	0.33
86_H	91_R	0.571	0.32
21_K	87_I	0.569	0.32
139_L	142_Q	0.567	0.32
132_V	137_E	0.565	0.32
46_K	97_V	0.564	0.32
51_V	55_L	0.564	0.32
28_R	40_L	0.563	0.32
33_S	79_L	0.558	0.31
106_L	114_S	0.556	0.31
10_V	116_E	0.554	0.31
48_P	101_N	0.553	0.31
46_K	125_R	0.551	0.31
53_A	65_R	0.549	0.31
19_K	123_R	0.547	0.30
63_A	111_L	0.547	0.30
53_A	102_V	0.545	0.30
76_L	145_L	0.542	0.30
141_L	147_M	0.542	0.30
20_L	49_E	0.541	0.30
60_H	147_M	0.541	0.30
15_P	18_K	0.540	0.30
55_L	142_Q	0.536	0.30
10_V	146_D	0.536	0.30
24_D	131_E	0.535	0.29
60_H	91_R	0.532	0.29
85_K	146_D	0.532	0.29
53_A	132_V	0.530	0.29
114_S	128_V	0.530	0.29
130_E	133_E	0.527	0.29
13_G	18_K	0.525	0.29
24_D	124_L	0.522	0.28
36_L	71_R	0.512	0.28
81_R	129_R	0.505	0.27
43_V	87_I	0.504	0.27
45_T	51_V	0.504	0.27
37_D	76_L	0.503	0.27
82_F	141_L	0.502	0.27
30_F	92_F	0.502	0.27
5_E	9_I	0.500	0.27
84_I	100_A	0.500	0.27

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
1k8kG	1	0.7838	63.1	0.896	Contact Map
3dwlG	1	0.6892	51.3	0.904	Contact Map
4cr2Z	1	0.8243	36.9	0.912	Contact Map
4bzjA	2	0.7973	31.2	0.915	Contact Map
4kmoB	1	0.8311	18.5	0.924	Contact Map
2rq5A	1	0.8176	8.6	0.934	Contact Map
4adyA	1	0.8784	7	0.937	Contact Map
3wozA	1	0.7432	6.3	0.938	Contact Map
2vj4A	1	0.8919	5.7	0.939	Contact Map
4uxvA	1	0.3378	5.5	0.94	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0059 seconds.