Sas10 - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Sas10 - Sas10 C-terminal domain

PFAM:	PF09368	Sequences: EDGKRAITYQIEKNKGLTPHRKKEVRNPRVKKRKKYEKAKKKRKGQVRVYRKEEGGYGGEATGIKANVVKSVKL	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	74 (73)
Sequences:	618 (415)
Seq/√Len:	48.6
META:	0.451

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
43_R	47_V	3.255	1.00
7_I	12_E	3.082	1.00
42_K	45_G	2.645	1.00
34_K	37_E	2.489	1.00
9_Y	15_K	2.464	1.00
33_R	37_E	2.331	1.00
24_E	34_K	2.329	1.00
37_E	41_K	2.324	1.00
32_K	35_K	2.055	1.00
48_R	70_K	1.985	0.99
44_K	49_V	1.818	0.99
36_Y	40_K	1.817	0.99
43_R	49_V	1.813	0.99
44_K	51_R	1.799	0.99
27_N	30_V	1.763	0.99
25_V	31_K	1.753	0.99
9_Y	13_K	1.625	0.98
52_K	56_G	1.615	0.98
58_G	61_A	1.539	0.97
15_K	26_R	1.533	0.97
57_Y	60_E	1.491	0.96
15_K	55_G	1.448	0.95
39_A	42_K	1.446	0.95
28_P	32_K	1.283	0.91
15_K	18_T	1.269	0.91
62_T	65_K	1.234	0.90
69_V	73_K	1.204	0.89
65_K	68_V	1.194	0.88
21_R	26_R	1.116	0.84
45_G	48_R	1.057	0.81
18_T	21_R	1.051	0.81
19_P	26_R	1.045	0.80
3_G	7_I	1.027	0.79
43_R	46_Q	1.025	0.79
7_I	11_I	1.022	0.79
8_T	12_E	1.004	0.78
4_K	9_Y	0.986	0.76
38_K	42_K	0.984	0.76
46_Q	66_A	0.963	0.75
26_R	30_V	0.903	0.70
22_K	25_V	0.875	0.67
32_K	41_K	0.860	0.66
6_A	12_E	0.830	0.63
7_I	56_G	0.824	0.63
45_G	50_Y	0.817	0.62
2_D	7_I	0.808	0.61
56_G	65_K	0.801	0.60
19_P	28_P	0.790	0.59
9_Y	26_R	0.781	0.58
14_N	39_A	0.777	0.58
60_E	63_G	0.763	0.57
37_E	66_A	0.760	0.56
8_T	56_G	0.750	0.55
68_V	71_S	0.737	0.54
24_E	31_K	0.736	0.54
8_T	11_I	0.735	0.54
40_K	43_R	0.731	0.53
71_S	74_L	0.729	0.53
33_R	72_V	0.729	0.53
32_K	36_Y	0.718	0.52
48_R	51_R	0.712	0.51
16_G	21_R	0.711	0.51
28_P	72_V	0.692	0.49
25_V	28_P	0.681	0.48
54_E	74_L	0.680	0.48
62_T	70_K	0.677	0.48
57_Y	63_G	0.669	0.47
42_K	46_Q	0.668	0.47
19_P	25_V	0.660	0.46
22_K	61_A	0.656	0.46
11_I	33_R	0.652	0.45
8_T	40_K	0.652	0.45
11_I	71_S	0.651	0.45
11_I	73_K	0.643	0.45
12_E	25_V	0.637	0.44
57_Y	64_I	0.636	0.44
31_K	35_K	0.633	0.44
66_A	70_K	0.631	0.43
30_V	36_Y	0.631	0.43
13_K	68_V	0.624	0.43
37_E	40_K	0.624	0.43
52_K	55_G	0.608	0.41
14_N	57_Y	0.602	0.40
66_A	72_V	0.601	0.40
62_T	68_V	0.591	0.39
20_H	36_Y	0.591	0.39
53_E	61_A	0.589	0.39
4_K	7_I	0.581	0.38
19_P	74_L	0.581	0.38
6_A	39_A	0.568	0.37
26_R	39_A	0.567	0.37
5_R	11_I	0.562	0.37
13_K	22_K	0.562	0.37
24_E	27_N	0.558	0.36
15_K	25_V	0.558	0.36
63_G	71_S	0.553	0.36
46_Q	65_K	0.533	0.34
15_K	23_K	0.530	0.34
17_L	29_R	0.527	0.33
52_K	66_A	0.520	0.33
25_V	32_K	0.518	0.33
13_K	57_Y	0.511	0.32
26_R	31_K	0.507	0.32
19_P	32_K	0.506	0.32
31_K	34_K	0.505	0.31
35_K	54_E	0.505	0.31
26_R	32_K	0.504	0.31
52_K	61_A	0.504	0.31
29_R	60_E	0.501	0.31
8_T	20_H	0.500	0.31

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
4ksrA	3	0.2297	1.6	0.93	Contact Map
1vptA	2	0	1.3	0.933	Contact Map
3bboI	1	0	1.1	0.936	Contact Map
2uxwA	2	0.3378	1.1	0.936	Contact Map
2c1mB	1	0.3108	1.1	0.936	Contact Map
1bxnI	3	0.2027	1	0.939	Contact Map
3zeyY	1	0.7162	0.9	0.939	Contact Map
1lkoA	3	0.4459	0.8	0.941	Contact Map
4ar2A	10	0.3514	0.8	0.942	Contact Map
3zey1	1	0.0946	0.7	0.943	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0049 seconds.