Phage_BR0599 - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

Phage_BR0599 - Phage conserved hypothetical protein BR0599

PFAM:	PF09356	Sequences: GWFAGGRLTWTSGANAGLSREIKSHTAGGTLTLWLPLPFPIAVGDTFTLTAGCDKTFATCRAKFNNAVNFRGFPHIPGND	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	80 (79)
Sequences:	8428 (6704)
Seq/√Len:	754.3
META:	0.91

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
57_F	67_A	4.417	1.00
54_D	59_T	3.400	1.00
56_T	59_T	2.278	1.00
57_F	75_H	1.971	1.00
20_R	37_L	1.914	1.00
61_R	67_A	1.876	1.00
31_L	49_L	1.849	1.00
7_R	19_S	1.839	1.00
53_C	60_C	1.835	1.00
24_S	32_T	1.810	1.00
9_T	48_T	1.763	1.00
51_A	63_K	1.718	1.00
2_W	51_A	1.707	1.00
10_W	37_L	1.675	1.00
66_N	69_N	1.655	1.00
4_A	24_S	1.652	1.00
25_H	29_G	1.583	1.00
2_W	63_K	1.557	1.00
1_G	4_A	1.491	1.00
11_T	48_T	1.488	1.00
42_A	45_D	1.485	1.00
70_F	74_P	1.451	1.00
9_T	19_S	1.445	1.00
58_A	62_A	1.429	1.00
11_T	46_T	1.348	1.00
8_L	47_F	1.302	1.00
12_S	46_T	1.283	1.00
15_N	39_F	1.262	1.00
9_T	50_T	1.252	1.00
23_K	34_W	1.240	1.00
57_F	74_P	1.235	1.00
18_L	38_P	1.232	1.00
51_A	64_F	1.224	1.00
33_L	37_L	1.193	1.00
7_R	50_T	1.155	1.00
57_F	61_R	1.145	1.00
73_F	76_I	1.109	1.00
26_T	30_T	1.072	1.00
59_T	63_K	1.047	1.00
10_W	15_N	1.047	1.00
21_E	34_W	1.027	1.00
12_S	16_A	1.018	1.00
10_W	47_F	1.008	1.00
6_G	52_G	1.007	1.00
14_A	42_A	1.006	1.00
5_G	52_G	1.002	1.00
41_I	45_D	0.969	1.00
11_T	16_A	0.928	1.00
60_C	66_N	0.906	1.00
10_W	45_D	0.896	1.00
14_A	39_F	0.893	1.00
14_A	45_D	0.891	1.00
4_A	25_H	0.868	1.00
59_T	64_F	0.854	1.00
8_L	49_L	0.844	1.00
12_S	45_D	0.813	1.00
37_L	41_I	0.798	1.00
8_L	33_L	0.797	1.00
10_W	20_R	0.767	1.00
25_H	31_L	0.763	1.00
15_N	18_L	0.763	1.00
53_C	66_N	0.753	1.00
54_D	58_A	0.752	1.00
4_A	54_D	0.744	1.00
11_T	17_G	0.744	1.00
14_A	40_P	0.717	1.00
15_N	37_L	0.717	1.00
67_A	74_P	0.706	1.00
26_T	32_T	0.703	1.00
18_L	37_L	0.697	1.00
59_T	62_A	0.696	1.00
13_G	17_G	0.692	1.00
5_G	21_E	0.690	1.00
61_R	65_N	0.678	1.00
23_K	32_T	0.673	1.00
58_A	61_R	0.669	1.00
25_H	28_G	0.655	1.00
15_N	20_R	0.654	1.00
21_E	35_L	0.651	1.00
1_G	25_H	0.648	1.00
3_F	49_L	0.645	1.00
20_R	33_L	0.644	1.00
25_H	63_K	0.644	1.00
10_W	41_I	0.642	1.00
76_I	79_N	0.632	1.00
55_K	70_F	0.626	1.00
22_I	47_F	0.615	1.00
31_L	47_F	0.610	1.00
15_N	41_I	0.595	1.00
40_P	45_D	0.583	1.00
21_E	78_G	0.579	1.00
15_N	38_P	0.578	1.00
8_L	20_R	0.576	1.00
20_R	38_P	0.574	1.00
15_N	40_P	0.572	1.00
12_S	17_G	0.571	1.00
52_G	63_K	0.571	1.00
15_N	45_D	0.570	1.00
13_G	16_A	0.567	1.00
12_S	15_N	0.564	1.00
53_C	59_T	0.562	1.00
62_A	65_N	0.562	1.00
20_R	23_K	0.556	1.00
68_V	73_F	0.552	1.00
23_K	52_G	0.550	1.00
25_H	30_T	0.544	1.00
17_G	22_I	0.541	1.00
52_G	78_G	0.536	1.00
3_F	25_H	0.534	1.00
65_N	68_V	0.532	1.00
7_R	48_T	0.528	1.00
10_W	18_L	0.523	1.00
73_F	77_P	0.508	1.00
11_T	47_F	0.507	1.00
32_T	35_L	0.506	1.00
71_R	75_H	0.504	1.00
34_W	38_P	0.502	1.00
16_A	46_T	0.500	1.00

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2gp4A	2	0.775	9.6	0.884	Contact Map
3myxA	1	0.8125	5.4	0.896	Contact Map
1brvA	1	0.0625	4.5	0.9	Contact Map
2yvlA	4	0.5125	4.4	0.901	Contact Map
1f2nA	12	0.5375	3.9	0.903	Contact Map
2ed6A	3	0.975	2.9	0.909	Contact Map
1ng0A	12	0.5375	2.8	0.91	Contact Map
2k9nA	1	0.7375	2.5	0.912	Contact Map
3vkgA	2	1	2.5	0.912	Contact Map
4akgA	2	1	2.5	0.913	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0049 seconds.