NuA4 - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

NuA4 - Histone acetyltransferase subunit NuA4

PFAM:	PF09340	Sequences: KELRELLKKKRELEEELAQLEKQIYDLETSYLEETAASSGGNIIKGFDGYLKSSKGSAADRRKRKFTDEDRLFSLSSVTS	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	80 (77)
Sequences:	604 (452)
Seq/√Len:	51.5
META:	0.407

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
17_L	21_E	3.421	1.00
10_K	14_E	2.837	1.00
27_L	30_S	2.797	1.00
41_G	46_G	2.482	1.00
33_E	63_K	2.222	1.00
35_T	42_N	2.141	1.00
32_L	72_L	2.019	1.00
8_K	12_E	1.982	1.00
4_R	11_R	1.966	1.00
25_Y	29_T	1.952	1.00
29_T	71_R	1.878	0.99
35_T	47_F	1.727	0.99
4_R	8_K	1.684	0.99
42_N	47_F	1.667	0.98
26_D	80_S	1.604	0.98
23_Q	27_L	1.567	0.98
66_F	75_L	1.478	0.97
45_K	70_D	1.460	0.96
47_F	52_K	1.411	0.96
42_N	46_G	1.396	0.95
2_E	27_L	1.392	0.95
9_K	23_Q	1.359	0.94
2_E	69_E	1.333	0.94
22_K	26_D	1.319	0.94
21_E	77_S	1.314	0.93
25_Y	71_R	1.296	0.93
39_S	45_K	1.286	0.93
8_K	14_E	1.270	0.92
18_A	22_K	1.239	0.91
7_L	15_E	1.239	0.91
31_Y	46_G	1.184	0.89
20_L	27_L	1.159	0.88
4_R	26_D	1.141	0.87
35_T	48_D	1.138	0.87
63_K	66_F	1.123	0.87
66_F	71_R	1.122	0.86
21_E	79_T	1.098	0.85
43_I	68_D	1.042	0.82
26_D	30_S	1.029	0.81
53_S	57_S	1.004	0.80
61_R	66_F	0.998	0.79
8_K	47_F	0.988	0.79
19_Q	22_K	0.979	0.78
44_I	72_L	0.969	0.77
11_R	14_E	0.956	0.76
8_K	64_R	0.945	0.75
15_E	50_Y	0.914	0.73
24_I	77_S	0.909	0.73
33_E	79_T	0.897	0.72
75_L	78_V	0.881	0.70
67_T	70_D	0.866	0.69
44_I	66_F	0.864	0.69
27_L	75_L	0.850	0.67
40_G	51_L	0.841	0.67
7_L	60_D	0.838	0.66
31_Y	47_F	0.817	0.64
48_D	51_L	0.816	0.64
7_L	10_K	0.812	0.64
13_L	49_G	0.808	0.63
8_K	58_A	0.794	0.62
40_G	65_K	0.793	0.62
10_K	21_E	0.793	0.62
4_R	79_T	0.769	0.60
74_S	77_S	0.769	0.60
29_T	72_L	0.769	0.60
31_Y	42_N	0.746	0.57
30_S	42_N	0.740	0.57
32_L	35_T	0.736	0.56
59_A	70_D	0.718	0.54
31_Y	41_G	0.715	0.54
17_L	24_I	0.714	0.54
75_L	80_S	0.712	0.54
9_K	12_E	0.711	0.54
25_Y	30_S	0.699	0.52
10_K	47_F	0.696	0.52
11_R	34_E	0.687	0.51
72_L	75_L	0.680	0.50
10_K	45_K	0.678	0.50
42_N	76_S	0.670	0.49
32_L	71_R	0.663	0.49
8_K	39_S	0.652	0.48
54_S	62_R	0.640	0.46
43_I	52_K	0.635	0.46
18_A	25_Y	0.621	0.44
35_T	41_G	0.618	0.44
25_Y	64_R	0.606	0.43
64_R	80_S	0.604	0.43
33_E	48_D	0.594	0.42
8_K	78_V	0.588	0.41
38_S	47_F	0.587	0.41
4_R	51_L	0.581	0.40
19_Q	54_S	0.580	0.40
9_K	63_K	0.577	0.40
23_Q	64_R	0.570	0.39
13_L	45_K	0.564	0.39
23_Q	69_E	0.559	0.38
14_E	71_R	0.554	0.38
5_E	33_E	0.553	0.37
22_K	52_K	0.543	0.37
4_R	65_K	0.542	0.36
16_E	27_L	0.538	0.36
31_Y	35_T	0.534	0.36
17_L	41_G	0.533	0.36
38_S	48_D	0.529	0.35
70_D	76_S	0.521	0.34
5_E	30_S	0.519	0.34
23_Q	76_S	0.517	0.34
5_E	62_R	0.515	0.34
55_K	61_R	0.512	0.34
12_E	16_E	0.509	0.33
15_E	19_Q	0.507	0.33
62_R	72_L	0.506	0.33
6_L	22_K	0.505	0.33
39_S	48_D	0.504	0.33
13_L	38_S	0.503	0.33
34_E	43_I	0.500	0.32

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
4ihfA	4	0.3125	28.6	0.862	Contact Map
1nkpB	1	0.375	14.9	0.879	Contact Map
2iu8A	3	0.35	14.9	0.879	Contact Map
3pmoA	3	0.3	14.3	0.88	Contact Map
3zidA	1	0.425	13.6	0.881	Contact Map
2wujA	2	0.2375	13.5	0.881	Contact Map
2yy0A	6	0.35	13.4	0.881	Contact Map
4e79A	3	0.4	13.3	0.882	Contact Map
3mtuE	2	0.65	13	0.883	Contact Map
3ra3B	1	0.3375	12.4	0.883	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0051 seconds.