ATG_C - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

ATG_C - Autophagy-related protein C terminal domain

PFAM:	PF09333	Sequences: ISLYANQPKDVREGLASGYKSLGRGLASGVTGIVAKPIEGAEKEGAGGFVKGVGKGVPGAVVKPVIGATDAVSKTLEGIRNTLDPDNRREEEDKYK	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	96 (85)
Sequences:	1184 (890)
Seq/√Len:	96.5
META:	0.476

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
36_K	39_E	4.330	1.00
33_I	60_A	3.167	1.00
22_L	71_A	3.001	1.00
68_A	72_V	2.705	1.00
74_K	77_E	2.618	1.00
32_G	59_G	2.596	1.00
10_D	82_T	2.596	1.00
71_A	75_T	2.560	1.00
21_S	74_K	2.541	1.00
41_A	49_F	2.366	1.00
45_G	48_G	2.302	1.00
66_I	69_T	1.977	1.00
50_V	54_G	1.909	1.00
18_G	71_A	1.867	1.00
54_G	58_P	1.827	1.00
13_E	17_S	1.824	1.00
58_P	62_V	1.706	1.00
36_K	55_K	1.670	1.00
44_E	51_K	1.571	1.00
17_S	74_K	1.499	1.00
48_G	52_G	1.475	1.00
11_V	79_I	1.469	1.00
40_G	48_G	1.399	0.99
12_R	16_A	1.277	0.99
18_G	78_G	1.233	0.99
52_G	59_G	1.225	0.99
40_G	52_G	1.185	0.98
17_S	22_L	1.184	0.98
40_G	44_E	1.184	0.98
69_T	76_L	1.182	0.98
70_D	73_S	1.175	0.98
29_G	67_G	1.156	0.98
44_E	55_K	1.119	0.97
77_E	80_R	1.095	0.97
78_G	81_N	1.025	0.96
26_L	68_A	1.020	0.95
27_A	31_T	1.014	0.95
22_L	68_A	1.006	0.95
32_G	56_G	0.977	0.94
30_V	60_A	0.934	0.93
28_S	63_K	0.919	0.92
54_G	57_V	0.918	0.92
37_P	41_A	0.906	0.92
65_V	69_T	0.902	0.92
57_V	60_A	0.881	0.91
41_A	46_A	0.860	0.89
32_G	36_K	0.855	0.89
52_G	56_G	0.850	0.89
58_P	61_V	0.838	0.88
34_V	37_P	0.837	0.88
25_G	70_D	0.819	0.87
85_P	88_R	0.815	0.87
56_G	59_G	0.810	0.86
19_Y	71_A	0.801	0.86
72_V	75_T	0.800	0.86
9_K	13_E	0.792	0.85
72_V	76_L	0.791	0.85
37_P	51_K	0.790	0.85
14_G	78_G	0.776	0.84
37_P	67_G	0.773	0.84
25_G	62_V	0.770	0.84
29_G	56_G	0.768	0.83
25_G	63_K	0.759	0.83
23_G	27_A	0.744	0.81
29_G	32_G	0.733	0.80
36_K	40_G	0.724	0.80
31_T	35_A	0.722	0.79
61_V	68_A	0.718	0.79
11_V	15_L	0.704	0.78
25_G	29_G	0.698	0.77
63_K	67_G	0.697	0.77
10_D	16_A	0.691	0.76
22_L	25_G	0.687	0.76
4_Y	7_Q	0.681	0.75
48_G	51_K	0.680	0.75
12_R	18_G	0.669	0.74
64_P	68_A	0.666	0.74
56_G	67_G	0.651	0.72
19_Y	23_G	0.649	0.72
37_P	56_G	0.647	0.72
47_G	66_I	0.640	0.71
5_A	11_V	0.637	0.70
66_I	74_K	0.631	0.70
80_R	85_P	0.629	0.69
20_K	23_G	0.629	0.69
34_V	43_K	0.629	0.69
16_A	60_A	0.622	0.69
75_T	78_G	0.621	0.69
49_F	53_V	0.620	0.68
29_G	37_P	0.619	0.68
16_A	22_L	0.615	0.68
15_L	38_I	0.613	0.68
20_K	57_V	0.612	0.67
73_S	77_E	0.601	0.66
79_I	82_T	0.600	0.66
38_I	56_G	0.600	0.66
46_A	49_F	0.592	0.65
45_G	49_F	0.591	0.65
61_V	64_P	0.587	0.64
17_S	20_K	0.587	0.64
25_G	71_A	0.582	0.64
63_K	70_D	0.576	0.63
13_E	33_I	0.569	0.62
19_Y	22_L	0.559	0.60
84_D	87_N	0.557	0.60
10_D	13_E	0.555	0.60
68_A	73_S	0.553	0.60
21_S	76_L	0.549	0.59
58_P	71_A	0.547	0.59
63_K	78_G	0.544	0.58
11_V	14_G	0.541	0.58
26_L	83_L	0.536	0.57
49_F	86_D	0.535	0.57
17_S	77_E	0.535	0.57
4_Y	22_L	0.535	0.57
32_G	45_G	0.531	0.57
34_V	39_E	0.530	0.56
26_L	50_V	0.528	0.56
67_G	70_D	0.523	0.55
22_L	26_L	0.518	0.55
36_K	66_I	0.517	0.55
45_G	56_G	0.513	0.54
23_G	85_P	0.513	0.54
12_R	82_T	0.513	0.54
5_A	62_V	0.506	0.53
21_S	71_A	0.501	0.52
70_D	83_L	0.500	0.52
46_A	50_V	0.500	0.52

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3godA	4	0.9062	6.1	0.908	Contact Map
2z86A	2	0.3438	5	0.912	Contact Map
4p9tA	3	0.9688	2.4	0.924	Contact Map
1okcA	1	0.75	2.4	0.925	Contact Map
3rf3A	2	1	2.3	0.926	Contact Map
4o5fA	2	0.7396	2.2	0.926	Contact Map
1dowA	1	0.9688	2.1	0.927	Contact Map
4bbjA	1	0.8125	2	0.928	Contact Map
2de0X	2	0.7604	1.9	0.928	Contact Map
4iuhA	1	0.3438	1.9	0.928	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0051 seconds.