NADH_dhqG_C - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

NADH_dhqG_C - NADH-ubiquinone oxidoreductase subunit G, C-terminal

PFAM:	PF09326	Sequences: QIEPASFGDAADIAALAGLGGKLDKAPFASPVEDFYLTNPIARASAVMAEC	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	51 (43)
Sequences:	5001 (2560)
Seq/√Len:	390.5
META:	0.902

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
39_N	42_A	3.744	1.00
13_I	16_L	2.625	1.00
9_D	12_D	2.570	1.00
11_A	14_A	2.097	1.00
14_A	17_A	1.993	1.00
39_N	50_E	1.712	1.00
34_D	37_L	1.632	1.00
46_A	50_E	1.625	1.00
37_L	42_A	1.517	1.00
47_V	51_C	1.454	1.00
12_D	15_A	1.341	1.00
29_A	33_E	1.310	1.00
40_P	44_A	1.295	1.00
14_A	18_G	1.253	1.00
37_L	49_A	1.208	1.00
34_D	39_N	1.189	1.00
35_F	51_C	1.163	1.00
37_L	44_A	1.119	1.00
45_S	48_M	1.058	1.00
15_A	19_L	1.055	1.00
38_T	42_A	1.043	1.00
36_Y	46_A	0.970	1.00
13_I	17_A	0.935	1.00
12_D	17_A	0.919	1.00
37_L	46_A	0.873	1.00
21_G	24_D	0.862	1.00
12_D	16_L	0.854	1.00
28_F	32_V	0.848	1.00
23_L	28_F	0.832	1.00
31_P	35_F	0.790	1.00
33_E	37_L	0.789	1.00
9_D	14_A	0.783	1.00
20_G	24_D	0.779	1.00
10_A	14_A	0.775	1.00
34_D	49_A	0.773	1.00
34_D	38_T	0.770	1.00
15_A	20_G	0.752	1.00
23_L	30_S	0.752	1.00
9_D	13_I	0.742	1.00
17_A	21_G	0.732	1.00
15_A	36_Y	0.726	1.00
30_S	33_E	0.687	0.99
32_V	49_A	0.681	0.99
28_F	33_E	0.670	0.99
44_A	50_E	0.663	0.99
38_T	47_V	0.661	0.99
33_E	48_M	0.659	0.99
28_F	41_I	0.656	0.99
46_A	51_C	0.655	0.99
47_V	50_E	0.646	0.99
40_P	43_R	0.629	0.99
19_L	23_L	0.623	0.99
45_S	51_C	0.603	0.99
38_T	46_A	0.593	0.98
35_F	38_T	0.575	0.98
16_L	19_L	0.571	0.98
33_E	49_A	0.541	0.97
9_D	15_A	0.533	0.97
14_A	29_A	0.527	0.97
10_A	22_K	0.526	0.97
23_L	26_A	0.525	0.97
32_V	38_T	0.510	0.96
19_L	24_D	0.503	0.96
38_T	49_A	0.500	0.96

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3achA	1	0.9216	6.4	0.864	Contact Map
1uwwA	2	0.9216	4.7	0.872	Contact Map
3pgbA	2	0.5882	2.4	0.889	Contact Map
2zvmU	1	0.2549	2.3	0.891	Contact Map
2kyjA	1	0.451	2.1	0.893	Contact Map
3ulkA	3	0.3922	1.5	0.901	Contact Map
2i53A	1	0.5294	1.4	0.903	Contact Map
3ig5A	1	0.902	1.3	0.906	Contact Map
4btpA	3	0.8824	1.3	0.906	Contact Map
4incA	2	0.0588	1.2	0.906	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0042 seconds.