DUF1981 - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

DUF1981 - Domain of unknown function (DUF1981)

PFAM:	PF09324	Sequences: KFLEKEELSNFNFQKDFLKPFEVIMANSKSPDIRELVLRCLSQMIQARGENIKSGWKTIFSVLTAAAKDSSESIVRLAFEIVE	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	83 (83)
Sequences:	877 (613)
Seq/√Len:	67.3
META:	0.502

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
34_R	69_D	4.970	1.00
39_R	77_L	2.792	1.00
59_I	63_L	2.447	1.00
25_M	62_V	2.234	1.00
25_M	66_A	2.169	1.00
21_F	54_S	2.033	1.00
22_E	61_S	2.021	1.00
52_I	59_I	1.928	1.00
5_K	18_L	1.803	1.00
38_L	81_I	1.802	1.00
14_Q	55_G	1.773	1.00
2_F	17_F	1.755	1.00
41_L	62_V	1.615	0.99
38_L	45_I	1.599	0.99
38_L	42_S	1.592	0.99
41_L	59_I	1.545	0.99
20_P	55_G	1.521	0.99
13_F	20_P	1.466	0.98
8_L	13_F	1.454	0.98
7_E	54_S	1.420	0.98
1_K	5_K	1.393	0.98
17_F	54_S	1.355	0.97
7_E	13_F	1.338	0.97
42_S	46_Q	1.338	0.97
66_A	69_D	1.290	0.97
1_K	4_E	1.263	0.96
8_L	11_F	1.240	0.96
7_E	11_F	1.234	0.96
70_S	76_R	1.229	0.96
73_S	83_E	1.211	0.95
36_L	40_C	1.207	0.95
23_V	27_N	1.203	0.95
18_L	33_I	1.202	0.95
1_K	10_N	1.177	0.94
66_A	78_A	1.130	0.93
27_N	64_T	1.127	0.93
5_K	50_E	1.108	0.92
48_R	64_T	1.069	0.91
2_F	66_A	1.040	0.90
4_E	33_I	1.033	0.89
4_E	48_R	1.016	0.89
77_L	81_I	0.996	0.88
44_M	47_A	0.989	0.87
5_K	12_N	0.965	0.86
22_E	62_V	0.950	0.85
16_D	43_Q	0.946	0.85
26_A	50_E	0.929	0.84
20_P	40_C	0.929	0.84
12_N	58_T	0.927	0.83
40_C	43_Q	0.925	0.83
18_L	65_A	0.916	0.83
2_F	32_D	0.915	0.83
24_I	59_I	0.899	0.82
3_L	11_F	0.894	0.81
13_F	40_C	0.891	0.81
19_K	41_L	0.880	0.80
26_A	32_D	0.872	0.80
3_L	52_I	0.856	0.78
25_M	28_S	0.851	0.78
74_I	78_A	0.846	0.77
63_L	81_I	0.844	0.77
1_K	12_N	0.843	0.77
44_M	49_G	0.839	0.77
68_K	71_S	0.835	0.77
50_E	65_A	0.830	0.76
62_V	79_F	0.817	0.75
48_R	57_K	0.815	0.75
3_L	6_E	0.814	0.75
72_E	76_R	0.763	0.70
41_L	80_E	0.763	0.70
37_V	52_I	0.761	0.70
74_I	81_I	0.758	0.69
47_A	68_K	0.748	0.68
79_F	83_E	0.742	0.68
31_P	65_A	0.738	0.67
69_D	75_V	0.735	0.67
8_L	44_M	0.735	0.67
19_K	22_E	0.729	0.66
30_S	60_F	0.728	0.66
19_K	75_V	0.717	0.65
39_R	51_N	0.711	0.64
15_K	22_E	0.711	0.64
4_E	10_N	0.689	0.62
77_L	80_E	0.688	0.62
4_E	9_S	0.671	0.60
57_K	62_V	0.665	0.59
5_K	24_I	0.661	0.59
27_N	40_C	0.660	0.59
43_Q	46_Q	0.659	0.59
39_R	45_I	0.638	0.56
30_S	63_L	0.638	0.56
22_E	28_S	0.632	0.55
74_I	79_F	0.624	0.54
13_F	17_F	0.618	0.54
38_L	78_A	0.615	0.53
6_E	12_N	0.614	0.53
21_F	55_G	0.609	0.53
18_L	72_E	0.606	0.52
22_E	26_A	0.597	0.51
45_I	49_G	0.587	0.50
19_K	36_L	0.584	0.50
42_S	81_I	0.583	0.50
14_Q	17_F	0.582	0.49
36_L	57_K	0.568	0.48
68_K	82_V	0.566	0.48
16_D	74_I	0.566	0.48
10_N	15_K	0.564	0.47
76_R	81_I	0.561	0.47
21_F	24_I	0.560	0.47
27_N	61_S	0.553	0.46
10_N	16_D	0.550	0.46
14_Q	36_L	0.548	0.45
42_S	70_S	0.544	0.45
71_S	76_R	0.536	0.44
7_E	10_N	0.535	0.44
9_S	40_C	0.534	0.44
51_N	55_G	0.526	0.43
15_K	53_K	0.521	0.42
19_K	25_M	0.518	0.42
4_E	73_S	0.517	0.42
14_Q	67_A	0.510	0.41
19_K	44_M	0.507	0.41
35_E	39_R	0.504	0.40
24_I	34_R	0.500	0.40

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
4qmhA	1	0.9157	76	0.806	Contact Map
1u6gC	1	0.9759	68.5	0.816	Contact Map
2qk2A	1	0.9277	65.9	0.819	Contact Map
2z6gA	1	1	59.7	0.826	Contact Map
4fddA	1	0.988	56.8	0.829	Contact Map
1wa5B	1	0.9398	56.7	0.829	Contact Map
3w3wA	1	0.9518	55.9	0.831	Contact Map
4g3aA	1	0.988	55.3	0.831	Contact Map
2qk1A	1	1	55.1	0.831	Contact Map
4qmiA	1	0.8795	53.9	0.832	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0048 seconds.