DUF1850 - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

DUF1850 - Domain of unknown function (DUF1850)

PFAM:	PF08905	Sequences: FTLSWTHSVEKTPVEEDYRVTGGGLVLVEARFKGFGAGMPPPPGAGLTLEDGWFVIRPNRPLPELVLRVSPVADHRLCIGGRCIPL	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	86 (86)
Sequences:	4718 (3121)
Seq/√Len:	336.6
META:	0.834

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
33_K	53_W	3.530	1.00
24_G	61_P	2.793	1.00
29_E	55_V	2.735	1.00
19_R	28_V	2.694	1.00
21_T	26_V	2.582	1.00
17_D	29_E	2.513	1.00
31_R	53_W	2.411	1.00
4_S	15_E	2.223	1.00
12_T	33_K	2.220	1.00
6_T	13_P	2.129	1.00
15_E	31_R	1.912	1.00
16_E	30_A	1.859	1.00
18_Y	27_L	1.826	1.00
29_E	57_R	1.783	1.00
69_V	74_D	1.702	1.00
4_S	13_P	1.687	1.00
62_L	65_L	1.628	1.00
10_E	39_M	1.620	1.00
5_W	14_V	1.602	1.00
50_E	55_V	1.574	1.00
17_D	31_R	1.561	1.00
24_G	63_P	1.541	1.00
21_T	24_G	1.525	1.00
76_R	83_C	1.482	1.00
70_S	73_A	1.447	1.00
14_V	39_M	1.401	1.00
30_A	40_P	1.345	1.00
10_E	37_A	1.331	1.00
2_T	15_E	1.317	1.00
72_V	75_H	1.242	1.00
4_S	76_R	1.226	1.00
4_S	78_C	1.222	1.00
2_T	17_D	1.208	1.00
3_L	67_L	1.201	1.00
10_E	34_G	1.179	1.00
26_V	59_N	1.176	1.00
31_R	55_V	1.167	1.00
78_C	83_C	1.154	1.00
12_T	34_G	1.140	1.00
19_R	26_V	1.138	1.00
46_G	50_E	1.048	1.00
44_G	47_L	1.044	1.00
70_S	75_H	1.002	1.00
26_V	61_P	0.978	1.00
10_E	14_V	0.967	1.00
79_I	82_R	0.948	1.00
10_E	38_G	0.905	1.00
14_V	70_S	0.903	1.00
70_S	74_D	0.879	1.00
50_E	53_W	0.854	1.00
13_P	76_R	0.844	1.00
12_T	36_G	0.832	1.00
16_E	37_A	0.829	1.00
76_R	85_P	0.827	1.00
27_L	58_P	0.812	1.00
32_F	35_F	0.803	1.00
42_P	45_A	0.794	1.00
30_A	56_I	0.777	1.00
10_E	41_P	0.776	1.00
81_G	84_I	0.774	1.00
43_P	46_G	0.770	1.00
17_D	28_V	0.768	1.00
1_F	25_L	0.749	1.00
79_I	84_I	0.747	0.99
9_V	37_A	0.732	0.99
10_E	40_P	0.723	0.99
69_V	86_L	0.722	0.99
35_F	54_F	0.720	0.99
30_A	39_M	0.716	0.99
62_L	66_V	0.708	0.99
28_V	59_N	0.706	0.99
20_V	79_I	0.706	0.99
35_F	41_P	0.704	0.99
26_V	60_R	0.699	0.99
43_P	47_L	0.696	0.99
43_P	49_L	0.689	0.99
3_L	75_H	0.689	0.99
12_T	38_G	0.679	0.99
9_V	16_E	0.675	0.99
42_P	56_I	0.674	0.99
15_E	53_W	0.657	0.99
9_V	38_G	0.650	0.99
18_Y	25_L	0.650	0.99
27_L	62_L	0.638	0.98
35_F	56_I	0.638	0.98
5_W	37_A	0.626	0.98
49_L	57_R	0.621	0.98
83_C	86_L	0.621	0.98
6_T	74_D	0.619	0.98
8_S	70_S	0.617	0.98
45_A	48_T	0.616	0.98
1_F	79_I	0.616	0.98
1_F	18_Y	0.611	0.98
10_E	54_F	0.606	0.98
8_S	69_V	0.603	0.98
74_D	85_P	0.603	0.98
1_F	69_V	0.599	0.98
40_P	54_F	0.595	0.98
23_G	26_V	0.591	0.97
5_W	39_M	0.591	0.97
41_P	44_G	0.581	0.97
8_S	71_P	0.580	0.97
19_R	24_G	0.580	0.97
9_V	39_M	0.580	0.97
59_N	84_I	0.576	0.97
20_V	77_L	0.563	0.97
10_E	33_K	0.562	0.97
11_K	34_G	0.558	0.96
12_T	40_P	0.556	0.96
6_T	11_K	0.555	0.96
74_D	79_I	0.550	0.96
12_T	39_M	0.549	0.96
46_G	57_R	0.548	0.96
15_E	33_K	0.545	0.96
32_F	41_P	0.544	0.96
6_T	76_R	0.543	0.96
50_E	84_I	0.540	0.96
36_G	40_P	0.535	0.95
13_P	33_K	0.534	0.95
32_F	37_A	0.533	0.95
80_G	84_I	0.531	0.95
63_P	80_G	0.524	0.95
5_W	10_E	0.524	0.95
43_P	48_T	0.517	0.94
4_S	83_C	0.510	0.94
42_P	49_L	0.509	0.94
30_A	58_P	0.509	0.94
82_R	85_P	0.506	0.94
9_V	34_G	0.500	0.93

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
4qtqA	1	0.6744	28.4	0.864	Contact Map
4rh7A	1	0.7558	15.7	0.88	Contact Map
3vkgA	2	0.7558	14	0.883	Contact Map
4akgA	2	0.7558	11.8	0.886	Contact Map
4m9dA	2	0.593	10.7	0.888	Contact Map
3hidA	2	0.593	7.9	0.895	Contact Map
2du3A	4	0.9767	7.5	0.896	Contact Map
3ecfA	2	0.6047	6.8	0.898	Contact Map
2du7A	7	0.9767	5	0.904	Contact Map
2d7uA	2	0.5814	4.8	0.905	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0051 seconds.