DUF1845 - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

DUF1845 - Domain of unknown function (DUF1845)

PFAM:	PF08900	Sequences: RPGALRSEVTLTLHTRQAQRLWHGRRADEGKKKPAIIGLPGFAARLRKIWRAAAQDDPYADWWLLRIEEALEEARAELQELIEQLDALLAQLPKGLSISVALSVQPVRVPLFFRSPYGYRAAYLLADYDQLVRKVLTAHHVGLISRDEAERWLREGGRALRSLFGLAQRYRFSGVTRDDFAANNARARAAIEKMGELPQDVLSGTRRSRFAPPIR	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	215 (209)
Sequences:	640 (471)
Seq/√Len:	32.6
META:	0.655

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
57_D	174_G	4.100	1.00
200_D	206_R	3.888	1.00
56_D	61_D	3.419	1.00
199_Q	203_S	3.417	1.00
207_R	211_A	2.826	1.00
25_R	36_I	2.813	1.00
62_W	198_P	2.788	1.00
43_A	113_F	2.781	1.00
175_V	180_F	2.692	1.00
61_D	177_R	2.682	1.00
75_R	127_D	2.618	1.00
52_A	170_Y	2.609	1.00
132_V	153_L	2.577	1.00
145_S	148_E	2.561	1.00
207_R	212_P	2.472	1.00
208_S	211_A	2.433	0.99
179_D	184_N	2.429	0.99
42_F	121_A	2.231	0.99
184_N	187_A	2.209	0.99
56_D	177_R	2.196	0.99
13_L	22_W	2.168	0.99
200_D	205_T	2.077	0.98
176_T	179_D	2.052	0.98
52_A	57_D	2.036	0.98
43_A	118_G	1.967	0.97
160_L	163_L	1.949	0.97
178_D	182_A	1.947	0.97
14_H	115_S	1.940	0.97
63_W	66_R	1.887	0.97
111_L	122_A	1.872	0.97
77_E	159_A	1.819	0.96
65_L	201_V	1.798	0.96
178_D	181_A	1.790	0.96
139_H	149_A	1.788	0.96
100_V	137_T	1.758	0.95
183_N	188_R	1.742	0.95
193_K	197_L	1.738	0.95
15_T	18_A	1.701	0.94
69_E	206_R	1.678	0.94
158_R	162_S	1.617	0.92
57_D	173_S	1.586	0.92
188_R	191_I	1.581	0.92
63_W	170_Y	1.577	0.91
36_I	161_R	1.558	0.91
58_P	61_D	1.526	0.90
190_A	194_M	1.491	0.89
66_R	169_R	1.489	0.89
117_Y	208_S	1.480	0.89
135_V	149_A	1.478	0.88
78_L	131_L	1.425	0.87
52_A	60_A	1.401	0.86
158_R	169_R	1.398	0.85
42_F	167_A	1.371	0.84
49_I	141_V	1.346	0.83
27_A	71_L	1.344	0.83
14_H	133_R	1.341	0.83
181_A	184_N	1.336	0.83
103_S	106_P	1.332	0.83
42_F	136_L	1.328	0.82
52_A	111_L	1.325	0.82
164_F	209_R	1.304	0.81
68_E	209_R	1.303	0.81
52_A	172_F	1.293	0.81
119_Y	137_T	1.290	0.80
50_W	62_W	1.288	0.80
191_I	196_E	1.266	0.79
66_R	166_L	1.261	0.79
53_A	61_D	1.236	0.78
14_H	95_G	1.236	0.78
86_D	134_K	1.214	0.76
116_P	119_Y	1.192	0.75
180_F	187_A	1.189	0.75
188_R	192_E	1.186	0.74
157_G	161_R	1.182	0.74
53_A	64_L	1.170	0.73
46_L	118_G	1.170	0.73
39_L	42_F	1.170	0.73
183_N	187_A	1.147	0.72
208_S	212_P	1.138	0.71
123_Y	143_L	1.138	0.71
42_F	57_D	1.134	0.71
46_L	116_P	1.132	0.71
22_W	39_L	1.126	0.71
187_A	192_E	1.124	0.70
125_L	160_L	1.118	0.70
70_A	162_S	1.115	0.70
14_H	19_Q	1.090	0.68
85_L	135_V	1.077	0.67
19_Q	167_A	1.068	0.66
125_L	163_L	1.060	0.66
22_W	118_G	1.050	0.65
50_W	111_L	1.033	0.64
35_A	41_G	1.020	0.63
86_D	90_A	1.019	0.63
185_A	189_A	1.018	0.63
128_Y	201_V	1.004	0.62
182_A	200_D	0.996	0.61
39_L	121_A	0.985	0.60
38_G	42_F	0.983	0.60
46_L	121_A	0.982	0.60
147_D	151_R	0.979	0.60
22_W	134_K	0.978	0.59
27_A	35_A	0.977	0.59
21_L	160_L	0.976	0.59
133_R	137_T	0.974	0.59
181_A	185_A	0.974	0.59
184_N	190_A	0.973	0.59
101_A	140_H	0.973	0.59
117_Y	137_T	0.968	0.59
196_E	199_Q	0.966	0.59
21_L	115_S	0.962	0.58
149_A	153_L	0.960	0.58
59_Y	195_G	0.943	0.57
58_P	177_R	0.940	0.56
22_W	43_A	0.939	0.56
39_L	119_Y	0.930	0.56
180_F	184_N	0.919	0.55
36_I	41_G	0.918	0.55
46_L	67_I	0.914	0.54
51_R	55_Q	0.909	0.54
68_E	125_L	0.909	0.54
178_D	191_I	0.905	0.54
17_Q	22_W	0.903	0.53
98_I	144_I	0.902	0.53
76_A	160_L	0.898	0.53
71_L	83_E	0.897	0.53
81_L	84_Q	0.896	0.53
7_S	167_A	0.885	0.52
17_Q	136_L	0.882	0.52
132_V	152_W	0.879	0.51
44_A	51_R	0.873	0.51
61_D	207_R	0.870	0.51
121_A	164_F	0.862	0.50
49_I	60_A	0.862	0.50
14_H	22_W	0.861	0.50
64_L	137_T	0.861	0.50
37_I	154_R	0.850	0.49
25_R	35_A	0.848	0.49
117_Y	134_K	0.845	0.49
94_K	130_Q	0.844	0.49
111_L	198_P	0.839	0.48
61_D	179_D	0.823	0.47
186_R	189_A	0.820	0.47
82_I	98_I	0.817	0.46
75_R	120_R	0.817	0.46
95_G	130_Q	0.812	0.46
39_L	125_L	0.808	0.46
180_F	209_R	0.803	0.45
42_F	46_L	0.803	0.45
87_A	91_Q	0.798	0.45
113_F	122_A	0.794	0.44
178_D	199_Q	0.793	0.44
60_A	64_L	0.787	0.44
22_W	115_S	0.780	0.43
46_L	170_Y	0.778	0.43
11_L	126_A	0.777	0.43
4_A	80_E	0.776	0.43
42_F	67_I	0.772	0.43
5_L	15_T	0.772	0.43
142_G	188_R	0.762	0.42
57_D	136_L	0.760	0.42
50_W	116_P	0.759	0.42
13_L	153_L	0.755	0.41
158_R	166_L	0.753	0.41
113_F	117_Y	0.752	0.41
74_A	163_L	0.752	0.41
17_Q	170_Y	0.751	0.41
178_D	187_A	0.748	0.41
109_V	169_R	0.746	0.41
62_W	66_R	0.744	0.40
128_Y	160_L	0.738	0.40
24_G	161_R	0.734	0.40
75_R	133_R	0.729	0.39
43_A	50_W	0.723	0.39
25_R	161_R	0.722	0.39
186_R	200_D	0.719	0.38
134_K	137_T	0.719	0.38
75_R	123_Y	0.719	0.38
6_R	104_V	0.716	0.38
76_A	83_E	0.716	0.38
2_P	133_R	0.714	0.38
111_L	133_R	0.707	0.37
46_L	100_V	0.705	0.37
127_D	142_G	0.701	0.37
195_G	208_S	0.699	0.37
82_I	86_D	0.695	0.37
6_R	162_S	0.693	0.36
118_G	138_A	0.693	0.36
98_I	126_A	0.692	0.36
79_Q	127_D	0.690	0.36
159_A	162_S	0.688	0.36
21_L	77_E	0.683	0.36
143_L	162_S	0.681	0.35
137_T	141_V	0.681	0.35
182_A	188_R	0.679	0.35
183_N	186_R	0.674	0.35
187_A	191_I	0.673	0.35
17_Q	112_F	0.670	0.35
72_E	76_A	0.670	0.35
147_D	201_V	0.663	0.34
20_R	44_A	0.662	0.34
50_W	122_A	0.661	0.34
25_R	28_D	0.660	0.34
67_I	96_L	0.658	0.34
71_L	148_E	0.655	0.34
79_Q	132_V	0.650	0.33
176_T	180_F	0.650	0.33
81_L	144_I	0.648	0.33
113_F	119_Y	0.647	0.33
18_A	24_G	0.647	0.33
49_I	108_R	0.643	0.33
36_I	109_V	0.642	0.33
60_A	175_V	0.641	0.32
98_I	136_L	0.641	0.32
184_N	212_P	0.639	0.32
18_A	133_R	0.638	0.32
18_A	177_R	0.636	0.32
17_Q	137_T	0.629	0.32
94_K	127_D	0.627	0.31
147_D	205_T	0.627	0.31
124_L	156_G	0.625	0.31
20_R	59_Y	0.625	0.31
91_Q	96_L	0.624	0.31
11_L	41_G	0.622	0.31
78_L	167_A	0.620	0.31
136_L	140_H	0.620	0.31
12_T	15_T	0.619	0.31
73_E	191_I	0.616	0.31
49_I	67_I	0.612	0.30
18_A	21_L	0.612	0.30
87_A	151_R	0.609	0.30
85_L	175_V	0.609	0.30
89_L	145_S	0.609	0.30
171_R	174_G	0.607	0.30
68_E	93_P	0.606	0.30
68_E	131_L	0.604	0.30
71_L	192_E	0.603	0.30
87_A	110_P	0.601	0.30
4_A	153_L	0.600	0.30
114_R	210_F	0.600	0.30
64_L	122_A	0.600	0.30
89_L	138_A	0.597	0.29
120_R	142_G	0.595	0.29
88_L	125_L	0.593	0.29
39_L	43_A	0.589	0.29
103_S	113_F	0.589	0.29
59_Y	175_V	0.588	0.29
185_A	193_K	0.582	0.28
30_G	162_S	0.581	0.28
181_A	202_L	0.581	0.28
96_L	193_K	0.580	0.28
163_L	166_L	0.580	0.28
146_R	150_E	0.580	0.28
115_S	171_R	0.576	0.28
156_G	160_L	0.569	0.27
162_S	167_A	0.569	0.27
95_G	119_Y	0.567	0.27
57_D	138_A	0.567	0.27
178_D	183_N	0.567	0.27
40_P	96_L	0.564	0.27
86_D	143_L	0.564	0.27
24_G	36_I	0.563	0.27
128_Y	157_G	0.562	0.27
95_G	133_R	0.561	0.27
145_S	209_R	0.561	0.27
130_Q	145_S	0.560	0.27
46_L	164_F	0.560	0.27
142_G	149_A	0.559	0.27
60_A	129_D	0.559	0.27
16_R	33_K	0.558	0.27
17_Q	128_Y	0.558	0.27
59_Y	90_A	0.558	0.27
155_E	158_R	0.557	0.27
64_L	117_Y	0.556	0.27
47_R	50_W	0.554	0.27
53_A	119_Y	0.554	0.27
111_L	137_T	0.552	0.26
83_E	155_E	0.550	0.26
173_S	194_M	0.549	0.26
71_L	163_L	0.548	0.26
107_V	111_L	0.547	0.26
191_I	203_S	0.546	0.26
176_T	182_A	0.542	0.26
133_R	189_A	0.540	0.26
61_D	138_A	0.537	0.25
56_D	207_R	0.536	0.25
10_T	114_R	0.536	0.25
122_A	208_S	0.535	0.25
71_L	188_R	0.534	0.25
119_Y	139_H	0.533	0.25
127_D	137_T	0.533	0.25
155_E	201_V	0.529	0.25
96_L	135_V	0.529	0.25
68_E	161_R	0.529	0.25
39_L	67_I	0.528	0.25
74_A	157_G	0.527	0.25
9_V	137_T	0.526	0.25
60_A	177_R	0.525	0.25
175_V	184_N	0.521	0.24
90_A	182_A	0.520	0.24
128_Y	132_V	0.518	0.24
59_Y	187_A	0.518	0.24
14_H	109_V	0.513	0.24
53_A	132_V	0.513	0.24
201_V	208_S	0.512	0.24
9_V	19_Q	0.511	0.24
26_R	67_I	0.510	0.24
138_A	152_W	0.508	0.24
22_W	113_F	0.508	0.24
20_R	29_E	0.505	0.23
56_D	131_L	0.504	0.23
73_E	200_D	0.502	0.23
135_V	152_W	0.500	0.23
76_A	80_E	0.500	0.23

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2r25A	1	0.3907	27.7	0.946	Contact Map
1pp9F	1	0.2651	18.7	0.95	Contact Map
4eukB	1	0.4279	16.5	0.952	Contact Map
3iqtA	1	0.3674	15.4	0.952	Contact Map
2cw9A	1	0.3116	14	0.953	Contact Map
3myfA	3	0.3721	13.6	0.953	Contact Map
3j20D	1	0.4326	9.9	0.956	Contact Map
4u4cA	1	0.707	9.7	0.956	Contact Map
4pacA	1	0.414	9.2	0.957	Contact Map
4a4zA	1	0.7023	8.3	0.958	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0074 seconds.