FRG - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

FRG - FRG domain

PFAM:	PF08867	Sequences: SRLLFRGQSDASWPLLPSLYRLGGKKLSKLELERRLLREFRRRAHPYLSSPPDSDWDLEWLALAQHYGLPTRLLDWTESPLVALYFAVEDADDKDE	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	96 (90)
Sequences:	18277 (15372)
Seq/√Len:	1620.3
META:	0.934

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
64_A	69_L	4.553	1.00
8_Q	13_W	4.313	1.00
17_P	20_Y	3.182	1.00
4_L	76_W	2.685	1.00
41_R	60_W	2.411	1.00
65_Q	71_T	2.350	1.00
10_D	13_W	2.342	1.00
33_E	72_R	2.101	1.00
9_S	13_W	2.092	1.00
56_W	59_E	1.802	1.00
15_L	74_L	1.790	1.00
4_L	78_E	1.760	1.00
9_S	90_D	1.639	1.00
18_S	65_Q	1.639	1.00
16_L	24_G	1.529	1.00
39_E	42_R	1.528	1.00
48_L	51_P	1.470	1.00
85_Y	89_E	1.438	1.00
61_L	73_L	1.434	1.00
44_A	48_L	1.262	1.00
16_L	20_Y	1.248	1.00
61_L	72_R	1.229	1.00
9_S	89_E	1.221	1.00
8_Q	14_P	1.207	1.00
39_E	43_R	1.186	1.00
81_L	84_L	1.173	1.00
41_R	45_H	1.171	1.00
17_P	74_L	1.162	1.00
54_S	57_D	1.158	1.00
30_L	34_R	1.141	1.00
8_Q	15_L	1.133	1.00
33_E	36_L	1.129	1.00
45_H	48_L	1.123	1.00
21_R	65_Q	1.093	1.00
4_L	62_A	1.082	1.00
79_S	82_V	1.068	1.00
61_L	64_A	1.050	1.00
37_L	64_A	1.048	1.00
40_F	64_A	1.043	1.00
18_S	70_P	1.041	1.00
60_W	63_L	1.040	1.00
73_L	77_T	1.040	1.00
81_L	88_V	1.039	1.00
33_E	40_F	1.027	1.00
38_R	42_R	1.024	1.00
31_E	35_R	1.023	1.00
63_L	67_Y	1.020	1.00
65_Q	75_D	1.004	1.00
40_F	44_A	0.961	1.00
35_R	39_E	0.959	1.00
44_A	47_Y	0.930	1.00
80_P	84_L	0.929	1.00
26_K	29_K	0.924	1.00
36_L	40_F	0.899	1.00
19_L	72_R	0.893	1.00
37_L	61_L	0.885	1.00
4_L	64_A	0.878	1.00
15_L	76_W	0.871	1.00
32_L	35_R	0.867	1.00
62_A	76_W	0.865	1.00
13_W	21_R	0.864	1.00
79_S	85_Y	0.854	1.00
44_A	60_W	0.844	1.00
35_R	38_R	0.831	1.00
20_Y	65_Q	0.818	1.00
22_L	26_K	0.811	1.00
3_L	85_Y	0.806	1.00
34_R	38_R	0.802	1.00
50_S	53_D	0.797	1.00
25_K	29_K	0.792	1.00
43_R	46_P	0.786	1.00
42_R	45_H	0.778	1.00
68_G	85_Y	0.776	1.00
9_S	91_A	0.768	1.00
53_D	56_W	0.768	1.00
41_R	55_D	0.758	1.00
22_L	70_P	0.758	1.00
53_D	57_D	0.758	1.00
17_P	22_L	0.744	1.00
49_S	52_P	0.744	1.00
72_R	88_V	0.743	1.00
24_G	28_S	0.743	1.00
37_L	41_R	0.735	1.00
72_R	76_W	0.733	1.00
8_Q	21_R	0.730	1.00
36_L	69_L	0.729	1.00
22_L	25_K	0.729	1.00
66_H	75_D	0.726	1.00
77_T	82_V	0.723	1.00
77_T	85_Y	0.719	1.00
66_H	71_T	0.717	1.00
23_G	27_L	0.701	1.00
36_L	70_P	0.695	1.00
72_R	81_L	0.690	1.00
84_L	88_V	0.683	1.00
43_R	47_Y	0.675	1.00
12_S	15_L	0.666	1.00
65_Q	86_F	0.660	1.00
64_A	72_R	0.658	1.00
72_R	85_Y	0.654	1.00
46_P	50_S	0.650	1.00
18_S	71_T	0.635	1.00
52_P	60_W	0.635	1.00
8_Q	11_A	0.634	1.00
75_D	86_F	0.627	1.00
77_T	81_L	0.619	1.00
48_L	52_P	0.616	1.00
20_Y	23_G	0.600	1.00
8_Q	12_S	0.598	1.00
47_Y	50_S	0.594	1.00
61_L	71_T	0.590	1.00
77_T	83_A	0.585	1.00
37_L	40_F	0.582	1.00
73_L	76_W	0.582	1.00
42_R	46_P	0.581	1.00
5_F	83_A	0.576	1.00
13_W	16_L	0.573	1.00
8_Q	18_S	0.571	1.00
65_Q	68_G	0.565	1.00
31_E	34_R	0.561	1.00
80_P	85_Y	0.557	1.00
61_L	70_P	0.552	1.00
40_F	63_L	0.552	1.00
62_A	71_T	0.545	1.00
48_L	55_D	0.542	1.00
41_R	46_P	0.538	1.00
52_P	57_D	0.535	1.00
51_P	54_S	0.535	1.00
63_L	76_W	0.527	1.00
10_D	14_P	0.527	1.00
79_S	84_L	0.527	1.00
40_F	48_L	0.509	1.00
55_D	58_L	0.506	1.00
88_V	91_A	0.505	1.00
52_P	56_W	0.500	1.00

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2kxiA	1	0.8958	45.8	0.851	Contact Map
1urjA	1	0.8646	4.1	0.91	Contact Map
4qb0A	1	0.6667	3.7	0.912	Contact Map
4innA	1	0.0938	3.1	0.915	Contact Map
4tlvA	4	0.6458	3.1	0.915	Contact Map
1tiiA	1	0.7396	3	0.916	Contact Map
4k6lG	1	0.6458	2.9	0.916	Contact Map
3rmrA	5	0.2604	2.8	0.917	Contact Map
4yo7A	1	0	2.4	0.919	Contact Map
4pgiA	1	0.2708	2.3	0.921	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0047 seconds.