DGC - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

DGC - DGC domain

PFAM:	PF08859	Sequences: LIYACSGGSNVGQLARQAARKLTREGDAEMSCLAGVGGGVEGLVKSAKSARPIIAIDGCPLACAKKILEKAGIKPDRHIVLTDLGIEKGKTLDFTPEEIEKVVEAV	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	106 (103)
Sequences:	5171 (3086)
Seq/√Len:	304.1
META:	0.93

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
39_G	70_K	4.370	1.00
62_A	80_V	3.319	1.00
55_A	64_A	3.298	1.00
65_K	69_E	2.839	1.00
80_V	83_D	2.580	1.00
55_A	68_L	2.343	1.00
62_A	65_K	2.139	1.00
65_K	78_H	2.054	1.00
98_E	101_K	2.038	1.00
45_K	49_S	2.028	1.00
45_K	48_K	1.993	1.00
2_I	28_A	1.982	1.00
21_K	25_E	1.936	1.00
39_G	71_A	1.877	1.00
42_G	46_S	1.780	1.00
13_Q	16_R	1.701	1.00
15_A	56_I	1.625	1.00
19_A	30_M	1.608	1.00
13_Q	17_Q	1.590	1.00
52_P	77_R	1.527	1.00
41_E	45_K	1.486	1.00
87_E	90_K	1.482	1.00
96_P	100_E	1.482	1.00
40_V	43_L	1.466	1.00
62_A	78_H	1.447	1.00
16_R	20_R	1.436	1.00
25_E	103_V	1.427	1.00
69_E	74_K	1.336	1.00
19_A	56_I	1.332	1.00
3_Y	31_S	1.317	1.00
21_K	103_V	1.294	1.00
79_I	84_L	1.289	1.00
35_G	43_L	1.251	1.00
44_V	48_K	1.214	1.00
18_A	102_V	1.211	1.00
95_T	98_E	1.168	1.00
57_D	78_H	1.160	1.00
66_K	69_E	1.135	1.00
17_Q	96_P	1.130	1.00
54_I	79_I	1.129	1.00
33_L	64_A	1.120	1.00
37_G	67_I	1.111	1.00
55_A	78_H	1.094	1.00
97_E	101_K	1.079	1.00
18_A	22_L	1.077	1.00
84_L	102_V	1.023	1.00
4_A	19_A	1.020	1.00
29_E	46_S	1.001	1.00
36_V	68_L	0.996	1.00
91_T	94_F	0.994	1.00
52_P	76_D	0.992	1.00
94_F	99_I	0.991	1.00
6_S	30_M	0.988	1.00
10_N	86_I	0.986	1.00
53_I	73_I	0.983	1.00
7_G	32_C	0.979	1.00
86_I	98_E	0.938	1.00
62_A	82_T	0.936	1.00
17_Q	21_K	0.927	1.00
14_L	86_I	0.924	1.00
35_G	40_V	0.921	1.00
6_S	16_R	0.911	1.00
89_G	92_L	0.897	1.00
31_S	47_A	0.894	1.00
24_R	93_D	0.892	1.00
39_G	44_V	0.889	1.00
21_K	100_E	0.870	1.00
96_P	99_I	0.866	1.00
10_N	14_L	0.862	1.00
85_G	88_K	0.848	1.00
57_D	65_K	0.841	1.00
40_V	44_V	0.836	1.00
3_Y	53_I	0.829	1.00
4_A	15_A	0.812	1.00
21_K	24_R	0.810	1.00
68_L	73_I	0.809	1.00
18_A	103_V	0.798	1.00
3_Y	68_L	0.797	1.00
1_L	31_S	0.797	1.00
17_Q	94_F	0.797	1.00
100_E	103_V	0.793	1.00
66_K	70_K	0.783	0.99
23_T	30_M	0.778	0.99
86_I	89_G	0.772	0.99
14_L	99_I	0.770	0.99
93_D	96_P	0.747	0.99
60_P	82_T	0.744	0.99
23_T	28_A	0.739	0.99
18_A	81_L	0.734	0.99
69_E	76_D	0.734	0.99
99_I	103_V	0.733	0.99
53_I	68_L	0.732	0.99
43_L	47_A	0.731	0.99
38_G	67_I	0.730	0.99
59_C	63_C	0.727	0.99
35_G	38_G	0.702	0.99
10_N	13_Q	0.700	0.99
17_Q	20_R	0.697	0.99
11_V	82_T	0.694	0.99
91_T	98_E	0.688	0.99
95_T	99_I	0.685	0.99
31_S	43_L	0.685	0.99
31_S	35_G	0.678	0.99
3_Y	47_A	0.672	0.98
31_S	46_S	0.668	0.98
1_L	53_I	0.665	0.98
53_I	76_D	0.663	0.98
93_D	99_I	0.651	0.98
43_L	46_S	0.646	0.98
94_F	98_E	0.646	0.98
91_T	95_T	0.641	0.98
42_G	61_L	0.632	0.98
96_P	101_K	0.626	0.98
38_G	66_K	0.616	0.97
41_E	48_K	0.611	0.97
6_S	13_Q	0.604	0.97
47_A	73_I	0.599	0.97
67_I	70_K	0.598	0.97
32_C	88_K	0.595	0.97
23_T	31_S	0.593	0.97
17_Q	99_I	0.592	0.97
97_E	100_E	0.590	0.96
11_V	86_I	0.588	0.96
32_C	35_G	0.585	0.96
98_E	102_V	0.583	0.96
15_A	19_A	0.582	0.96
34_A	67_I	0.578	0.96
22_L	28_A	0.572	0.96
14_L	81_L	0.569	0.96
14_L	18_A	0.569	0.96
54_I	76_D	0.568	0.96
13_Q	20_R	0.566	0.96
87_E	91_T	0.564	0.95
90_K	98_E	0.561	0.95
89_G	98_E	0.560	0.95
44_V	73_I	0.559	0.95
35_G	61_L	0.557	0.95
35_G	47_A	0.557	0.95
33_L	67_I	0.536	0.94
41_E	46_S	0.527	0.93
48_K	73_I	0.524	0.93
39_G	72_G	0.521	0.93
3_Y	6_S	0.520	0.93
8_G	33_L	0.518	0.93
55_A	75_P	0.518	0.93
36_V	73_I	0.518	0.93
15_A	81_L	0.517	0.93
10_N	16_R	0.516	0.93
95_T	101_K	0.513	0.93
89_G	95_T	0.507	0.92
33_L	36_V	0.507	0.92
60_P	83_D	0.500	0.92
32_C	60_P	0.500	0.92
17_Q	24_R	0.500	0.92

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
1zj8A	1	0.8679	58.4	0.852	Contact Map
2akjA	1	0.8491	57.2	0.853	Contact Map
3b0gA	1	0.8491	56.7	0.854	Contact Map
4g38A	1	0.8679	50.3	0.859	Contact Map
2l17A	1	0.9528	45.3	0.863	Contact Map
5c4iA	2	0.9717	39.7	0.868	Contact Map
4lrqA	2	1	33.4	0.873	Contact Map
3ju3A	4	0.9151	28	0.878	Contact Map
1yd7A	1	0	28	0.878	Contact Map
3jviA	1	0.9717	26.6	0.879	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0053 seconds.