CGGC - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

CGGC - CGGC domain

PFAM:	PF08821	Sequences: KIGIIICDRYRDRCAGGKCFKALREREGAFARYKEEVELVGFTTCGGCPGGNIEYRPEEMKKNGADVIHLATCIVKGVGYPPCPYIEYFKKFIEKKYGIKVVEGTH	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	106 (104)
Sequences:	3526 (1735)
Seq/√Len:	170.1
META:	0.907

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
90_K	94_E	3.781	1.00
33_Y	69_H	2.970	1.00
32_R	100_K	2.665	1.00
20_F	39_L	2.639	1.00
90_K	103_E	2.433	1.00
23_L	39_L	2.419	1.00
70_L	93_I	2.406	1.00
23_L	37_V	2.362	1.00
91_K	95_K	2.288	1.00
16_G	42_F	2.052	1.00
6_I	11_R	1.851	1.00
24_R	38_E	1.793	1.00
20_F	42_F	1.778	1.00
40_V	65_A	1.759	1.00
45_C	83_C	1.737	1.00
58_E	96_K	1.730	1.00
9_R	47_G	1.712	1.00
21_K	25_E	1.687	1.00
15_A	56_R	1.678	1.00
67_V	100_K	1.661	1.00
8_D	44_T	1.605	1.00
57_P	93_I	1.556	1.00
26_R	36_E	1.492	1.00
87_E	91_K	1.475	1.00
59_E	62_K	1.474	1.00
8_D	11_R	1.465	1.00
45_C	48_C	1.446	1.00
69_H	102_V	1.399	1.00
67_V	102_V	1.384	1.00
87_E	103_E	1.380	1.00
22_A	27_E	1.380	1.00
94_E	100_K	1.372	1.00
43_T	56_R	1.335	1.00
29_A	32_R	1.335	1.00
91_K	94_E	1.318	1.00
61_K	99_I	1.316	1.00
1_K	38_E	1.314	1.00
26_R	37_V	1.237	1.00
52_N	55_Y	1.225	1.00
3_G	41_G	1.223	1.00
33_Y	67_V	1.187	1.00
50_G	53_I	1.178	1.00
85_Y	88_Y	1.160	1.00
48_C	83_C	1.142	1.00
51_G	81_P	1.141	1.00
86_I	103_E	1.134	1.00
12_D	44_T	1.117	1.00
54_E	92_F	1.113	1.00
41_G	65_A	1.112	1.00
26_R	34_K	1.100	1.00
12_D	46_G	1.083	1.00
7_C	45_C	1.082	1.00
22_A	28_G	1.063	1.00
74_I	89_F	1.061	1.00
3_G	60_M	1.030	0.99
23_L	26_R	1.022	0.99
70_L	74_I	1.012	0.99
52_N	56_R	0.992	0.99
15_A	59_E	0.981	0.99
88_Y	91_K	0.961	0.99
7_C	83_C	0.957	0.99
13_R	55_Y	0.955	0.99
70_L	90_K	0.949	0.99
6_I	9_R	0.930	0.99
65_A	68_I	0.921	0.99
75_V	78_V	0.910	0.98
36_E	39_L	0.901	0.98
3_G	57_P	0.893	0.98
26_R	35_E	0.862	0.98
8_D	12_D	0.858	0.98
55_Y	59_E	0.827	0.97
26_R	33_Y	0.824	0.97
75_V	103_E	0.813	0.97
4_I	30_F	0.792	0.96
33_Y	37_V	0.782	0.96
74_I	86_I	0.780	0.96
20_F	24_R	0.772	0.96
30_F	33_Y	0.758	0.95
19_C	33_Y	0.748	0.95
56_R	61_K	0.744	0.95
3_G	65_A	0.744	0.95
53_I	93_I	0.743	0.95
58_E	62_K	0.741	0.95
7_C	48_C	0.725	0.94
1_K	64_G	0.708	0.93
46_G	50_G	0.705	0.93
92_F	96_K	0.704	0.93
75_V	79_G	0.686	0.92
2_I	67_V	0.686	0.92
51_G	55_Y	0.685	0.92
34_K	37_V	0.685	0.92
18_K	22_A	0.685	0.92
87_E	90_K	0.685	0.92
92_F	97_Y	0.682	0.92
86_I	104_G	0.681	0.92
8_D	46_G	0.676	0.92
2_I	37_V	0.673	0.91
9_R	12_D	0.672	0.91
41_G	60_M	0.668	0.91
14_C	19_C	0.664	0.91
88_Y	92_F	0.656	0.90
11_R	44_T	0.649	0.90
8_D	47_G	0.648	0.90
91_K	96_K	0.647	0.90
33_Y	102_V	0.644	0.90
70_L	86_I	0.641	0.89
2_I	69_H	0.639	0.89
68_I	99_I	0.631	0.89
17_G	63_N	0.622	0.88
85_Y	95_K	0.619	0.88
53_I	89_F	0.614	0.87
22_A	98_G	0.613	0.87
52_N	59_E	0.613	0.87
19_C	42_F	0.607	0.87
43_T	60_M	0.607	0.87
2_I	33_Y	0.604	0.86
50_G	55_Y	0.602	0.86
61_K	98_G	0.596	0.86
81_P	85_Y	0.596	0.86
65_A	99_I	0.594	0.86
4_I	23_L	0.590	0.85
75_V	86_I	0.590	0.85
99_I	103_E	0.587	0.85
40_V	64_G	0.587	0.85
20_F	28_G	0.584	0.85
57_P	68_I	0.583	0.84
53_I	74_I	0.579	0.84
101_V	106_H	0.578	0.84
50_G	54_E	0.577	0.84
31_A	100_K	0.576	0.84
5_I	84_P	0.572	0.83
58_E	92_F	0.570	0.83
34_K	94_E	0.569	0.83
54_E	96_K	0.569	0.83
16_G	43_T	0.569	0.83
73_C	105_T	0.562	0.82
69_H	105_T	0.558	0.82
35_E	66_D	0.558	0.82
69_H	104_G	0.555	0.82
9_R	44_T	0.553	0.81
1_K	66_D	0.553	0.81
19_C	22_A	0.549	0.81
70_L	85_Y	0.539	0.80
95_K	100_K	0.538	0.79
70_L	103_E	0.536	0.79
20_F	41_G	0.531	0.79
19_C	93_I	0.530	0.78
1_K	82_P	0.530	0.78
94_E	103_E	0.526	0.78
11_R	41_G	0.523	0.78
80_Y	104_G	0.523	0.78
71_A	74_I	0.514	0.76
21_K	72_T	0.512	0.76
34_K	91_K	0.508	0.76
9_R	49_P	0.507	0.75
50_G	60_M	0.500	0.74

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
1geqA	1	0.6226	78.1	0.873	Contact Map
2xedA	1	0.8019	70.7	0.881	Contact Map
4fq5B	4	0.8019	70.7	0.881	Contact Map
4ht3A	1	0.7264	66.4	0.884	Contact Map
3vndA	3	0.7358	63.4	0.886	Contact Map
3thaA	2	0.6698	57.1	0.89	Contact Map
3ixlA	1	0.7736	55.7	0.891	Contact Map
2dgdA	4	0.7736	54.7	0.892	Contact Map
2ekcA	1	0.7264	54.6	0.892	Contact Map
2g0tA	3	0.8491	53.9	0.893	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0052 seconds.