DUF1799 - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

DUF1799 - Phage related hypothetical protein (DUF1799)

PFAM:	PF08809	Sequences: FGLTPEDYEEEDFEVWPENWPAVELFLALQTQWRVGMGGATGLDYAAVPAVLRLLGVPREDRPELFEDLQVMEAAALEVM	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	80 (70)
Sequences:	1971 (1734)
Seq/√Len:	207.3
META:	0.868

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
34_R	44_D	4.252	1.00
22_A	68_D	3.063	1.00
49_P	53_R	2.957	1.00
29_L	48_V	1.978	1.00
20_W	24_E	1.909	1.00
64_E	68_D	1.908	1.00
31_T	42_G	1.864	1.00
75_A	78_E	1.844	1.00
25_L	52_L	1.798	1.00
31_T	45_Y	1.666	1.00
51_V	66_F	1.659	1.00
75_A	79_V	1.562	1.00
15_V	20_W	1.521	1.00
32_Q	45_Y	1.476	1.00
34_R	46_A	1.436	1.00
31_T	73_E	1.418	1.00
45_Y	73_E	1.392	1.00
44_D	47_A	1.317	1.00
72_M	75_A	1.310	1.00
54_L	63_P	1.308	1.00
16_W	19_N	1.308	1.00
52_L	62_R	1.276	1.00
49_P	54_L	1.262	1.00
28_A	55_L	1.233	1.00
33_W	43_L	1.223	1.00
35_V	41_T	1.207	1.00
71_V	75_A	1.166	1.00
19_N	68_D	1.161	1.00
47_A	50_A	1.130	1.00
51_V	55_L	1.116	1.00
36_G	40_A	1.088	1.00
72_M	76_A	1.088	1.00
15_V	23_V	1.082	1.00
35_V	40_A	1.079	1.00
28_A	70_Q	1.076	1.00
50_A	54_L	1.029	1.00
23_V	27_L	1.016	1.00
25_L	65_L	1.010	1.00
23_V	72_M	0.969	1.00
65_L	68_D	0.957	0.99
22_A	65_L	0.921	0.99
28_A	67_E	0.916	0.99
38_G	41_T	0.908	0.99
48_V	52_L	0.894	0.99
37_M	40_A	0.889	0.99
68_D	72_M	0.886	0.99
26_F	72_M	0.878	0.99
53_R	62_R	0.857	0.99
56_G	63_P	0.836	0.99
25_L	51_V	0.836	0.99
45_Y	70_Q	0.836	0.99
21_P	61_D	0.832	0.99
36_G	39_G	0.826	0.99
43_L	69_L	0.821	0.98
23_V	26_F	0.810	0.98
53_R	58_P	0.807	0.98
37_M	41_T	0.803	0.98
50_A	53_R	0.796	0.98
36_G	41_T	0.785	0.98
26_F	29_L	0.779	0.98
45_Y	66_F	0.771	0.98
55_L	67_E	0.768	0.98
59_R	62_R	0.746	0.97
22_A	72_M	0.741	0.97
58_P	61_D	0.732	0.97
52_L	57_V	0.729	0.97
48_V	69_L	0.710	0.96
34_R	42_G	0.709	0.96
26_F	76_A	0.705	0.96
73_E	77_L	0.703	0.96
32_Q	70_Q	0.674	0.95
35_V	38_G	0.667	0.95
29_L	51_V	0.664	0.95
66_F	70_Q	0.663	0.94
46_A	50_A	0.662	0.94
54_L	62_R	0.644	0.94
50_A	62_R	0.630	0.93
56_G	59_R	0.627	0.93
27_L	30_Q	0.618	0.92
22_A	25_L	0.617	0.92
25_L	48_V	0.614	0.92
49_P	62_R	0.612	0.92
46_A	49_P	0.609	0.92
11_E	27_L	0.605	0.91
74_A	78_E	0.603	0.91
52_L	59_R	0.597	0.91
15_V	19_N	0.595	0.91
40_A	77_L	0.594	0.91
23_V	71_V	0.592	0.90
42_G	45_Y	0.591	0.90
24_E	27_L	0.590	0.90
33_W	76_A	0.584	0.90
32_Q	47_A	0.577	0.89
31_T	77_L	0.572	0.89
24_E	28_A	0.563	0.88
25_L	55_L	0.559	0.88
47_A	51_V	0.554	0.87
54_L	66_F	0.550	0.87
29_L	49_P	0.546	0.87
30_Q	74_A	0.544	0.86
68_D	71_V	0.512	0.83
55_L	63_P	0.512	0.83
10_E	15_V	0.511	0.83
13_F	23_V	0.508	0.82
29_L	66_F	0.500	0.81

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
4uw8A	3	0.8125	8.9	0.899	Contact Map
4dgwA	1	0.325	8.1	0.901	Contact Map
3gw6A	3	0.85	7.7	0.902	Contact Map
4r0vA	1	0.8875	4.4	0.912	Contact Map
3lx4A	1	0.9	4.1	0.914	Contact Map
2k8yA	1	0.85	4.1	0.914	Contact Map
4phzB	3	0.7125	4	0.914	Contact Map
1yewB	3	0.7125	3.8	0.915	Contact Map
4l8kA	3	0.75	3.7	0.915	Contact Map
4l6yA	2	0.4625	3.6	0.916	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0051 seconds.