RES - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

RES - RES domain

PFAM:	PF08808	Sequences: TLYRIRRPKYLAAAPFSGEGARPYGGRFNSPGRGVLYAAESLATALAEVLVHRGRFLAATAEFPLLLPRDLRLLDLDIPDARLVDLTRPAALLPLGWRDPPPDYAATQALGDALRAAGSDGLRYPSVRVAPGETNLALFPDAHPDAVRIVIQGRHLRFRWD	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	161 (141)
Sequences:	25338 (19355)
Seq/√Len:	1629.9
META:	0.87

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
30_S	112_D	4.622	1.00
123_R	134_T	3.000	1.00
19_E	22_R	2.845	1.00
33_R	115_R	2.777	1.00
35_V	137_A	2.590	1.00
26_G	29_N	2.436	1.00
123_R	136_L	2.272	1.00
124_Y	137_A	2.079	1.00
114_L	119_S	2.000	1.00
40_E	136_L	1.894	1.00
39_A	44_T	1.867	1.00
40_E	123_R	1.846	1.00
22_R	34_G	1.821	1.00
33_R	112_D	1.733	1.00
42_L	73_L	1.719	1.00
112_D	116_A	1.700	1.00
93_L	96_G	1.697	1.00
41_S	129_V	1.690	1.00
30_S	33_R	1.684	1.00
122_L	137_A	1.592	1.00
97_W	100_P	1.592	1.00
81_A	85_D	1.587	1.00
121_G	136_L	1.573	1.00
49_V	71_L	1.545	1.00
30_S	108_Q	1.514	1.00
39_A	135_N	1.503	1.00
89_P	92_L	1.502	1.00
124_Y	135_N	1.479	1.00
19_E	23_P	1.475	1.00
83_L	86_L	1.431	1.00
104_Y	107_T	1.424	1.00
30_S	109_A	1.419	1.00
92_L	96_G	1.387	1.00
84_V	119_S	1.384	1.00
113_A	117_A	1.379	1.00
41_S	44_T	1.377	1.00
40_E	133_E	1.375	1.00
89_P	94_P	1.374	1.00
90_A	96_G	1.369	1.00
40_E	134_T	1.341	1.00
54_G	57_L	1.330	1.00
99_D	102_P	1.315	1.00
91_A	94_P	1.313	1.00
90_A	94_P	1.307	1.00
60_T	64_P	1.305	1.00
34_G	142_A	1.278	1.00
15_P	18_G	1.277	1.00
44_T	133_E	1.262	1.00
92_L	95_L	1.244	1.00
51_V	128_R	1.243	1.00
82_R	120_D	1.237	1.00
109_A	113_A	1.228	1.00
39_A	45_A	1.206	1.00
145_D	148_R	1.190	1.00
14_A	17_S	1.187	1.00
59_A	62_E	1.175	1.00
131_P	134_T	1.171	1.00
82_R	85_D	1.165	1.00
110_L	114_L	1.162	1.00
33_R	116_A	1.161	1.00
8_P	72_R	1.157	1.00
41_S	133_E	1.136	1.00
29_N	35_V	1.133	1.00
6_R	10_Y	1.115	1.00
14_A	18_G	1.107	1.00
40_E	44_T	1.095	1.00
90_A	93_L	1.077	1.00
111_G	139_F	1.074	1.00
55_R	58_A	1.069	1.00
35_V	115_R	1.060	1.00
12_A	15_P	1.047	1.00
25_G	29_N	1.035	1.00
32_G	112_D	1.021	1.00
53_R	56_F	1.017	1.00
143_H	146_A	1.009	1.00
114_L	122_L	1.000	1.00
61_A	64_P	1.000	1.00
43_A	129_V	0.999	1.00
68_P	71_L	0.999	1.00
25_G	31_P	0.995	1.00
85_D	123_R	0.993	1.00
83_L	121_G	0.991	1.00
21_A	25_G	0.987	1.00
89_P	93_L	0.983	1.00
120_D	146_A	0.971	1.00
146_A	149_I	0.964	1.00
13_A	17_S	0.957	1.00
113_A	116_A	0.951	1.00
67_L	70_D	0.924	1.00
91_A	95_L	0.924	1.00
81_A	120_D	0.912	1.00
60_T	63_F	0.909	1.00
19_E	34_G	0.907	1.00
121_G	138_L	0.905	1.00
13_A	16_F	0.903	1.00
44_T	126_S	0.896	1.00
36_L	76_L	0.894	1.00
70_D	73_L	0.891	1.00
59_A	63_F	0.886	1.00
112_D	115_R	0.881	1.00
106_A	109_A	0.881	1.00
44_T	129_V	0.871	1.00
46_L	50_L	0.865	1.00
28_F	124_Y	0.864	1.00
90_A	95_L	0.858	1.00
80_D	83_L	0.856	1.00
47_A	50_L	0.855	1.00
78_I	121_G	0.847	1.00
104_Y	108_Q	0.839	1.00
53_R	57_L	0.839	1.00
107_T	110_L	0.833	1.00
91_A	96_G	0.832	1.00
58_A	61_A	0.828	1.00
84_V	114_L	0.826	1.00
81_A	86_L	0.824	1.00
126_S	135_N	0.804	1.00
105_A	109_A	0.796	1.00
129_V	133_E	0.783	1.00
71_L	75_D	0.773	1.00
89_P	96_G	0.772	1.00
7_R	10_Y	0.771	1.00
47_A	129_V	0.771	1.00
144_P	147_V	0.769	1.00
79_P	82_R	0.760	1.00
13_A	18_G	0.756	1.00
105_A	108_Q	0.755	1.00
147_V	151_I	0.753	1.00
81_A	84_V	0.738	1.00
78_I	81_A	0.734	1.00
12_A	17_S	0.727	1.00
58_A	63_F	0.727	1.00
42_L	132_G	0.726	1.00
69_R	73_L	0.724	1.00
5_I	45_A	0.717	1.00
46_L	51_V	0.714	1.00
38_A	76_L	0.713	1.00
120_D	145_D	0.707	1.00
29_N	37_Y	0.703	1.00
89_P	95_L	0.699	1.00
67_L	71_L	0.697	1.00
100_P	103_D	0.696	1.00
70_D	74_L	0.696	1.00
103_D	107_T	0.694	1.00
20_G	23_P	0.692	1.00
38_A	138_L	0.686	1.00
43_A	133_E	0.680	1.00
110_L	113_A	0.676	1.00
35_V	111_G	0.674	1.00
77_D	150_V	0.673	1.00
136_L	139_F	0.672	1.00
120_D	140_P	0.669	1.00
6_R	15_P	0.663	1.00
54_G	58_A	0.660	1.00
115_R	142_A	0.657	1.00
143_H	147_V	0.654	1.00
109_A	112_D	0.647	1.00
52_H	55_R	0.644	1.00
78_I	83_L	0.643	1.00
142_A	147_V	0.641	1.00
82_R	86_L	0.640	1.00
106_A	110_L	0.639	1.00
148_R	151_I	0.635	1.00
69_R	74_L	0.634	1.00
98_R	102_P	0.634	1.00
39_A	48_E	0.633	1.00
8_P	12_A	0.628	1.00
6_R	9_K	0.625	1.00
97_W	102_P	0.624	1.00
12_A	16_F	0.618	1.00
76_L	149_I	0.617	1.00
111_G	122_L	0.616	1.00
68_P	74_L	0.615	1.00
6_R	74_L	0.614	1.00
56_F	60_T	0.608	1.00
40_E	129_V	0.607	1.00
140_P	145_D	0.607	1.00
58_A	62_E	0.603	1.00
24_Y	31_P	0.603	1.00
7_R	12_A	0.602	1.00
77_D	149_I	0.600	1.00
12_A	18_G	0.599	1.00
142_A	145_D	0.594	1.00
57_L	62_E	0.588	1.00
104_Y	112_D	0.584	1.00
43_A	47_A	0.583	1.00
3_Y	73_L	0.573	1.00
69_R	76_L	0.572	1.00
25_G	108_Q	0.570	1.00
98_R	125_P	0.569	1.00
3_Y	75_D	0.567	1.00
114_L	117_A	0.562	1.00
5_I	49_V	0.561	1.00
57_L	60_T	0.560	1.00
22_R	25_G	0.552	1.00
69_R	72_R	0.551	1.00
58_A	64_P	0.548	1.00
85_D	89_P	0.546	1.00
96_G	106_A	0.543	1.00
46_L	129_V	0.540	1.00
129_V	132_G	0.533	1.00
137_A	140_P	0.533	1.00
6_R	12_A	0.529	1.00
120_D	149_I	0.528	1.00
115_R	140_P	0.527	1.00
140_P	143_H	0.525	1.00
46_L	49_V	0.524	1.00
3_Y	42_L	0.523	1.00
128_R	131_P	0.523	1.00
59_A	64_P	0.521	1.00
135_N	139_F	0.511	1.00
15_P	19_E	0.509	1.00
47_A	128_R	0.500	1.00

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
4g29A	1	0.5155	5.3	0.926	Contact Map
1yz7A	1	0.2795	3	0.934	Contact Map
4nexA	2	0.354	2.5	0.937	Contact Map
1ehwA	4	0.354	2.3	0.938	Contact Map
3ztpA	3	0.3602	1.9	0.941	Contact Map
4nf1A	3	0.354	1.9	0.941	Contact Map
4k30A	2	0.3354	1.7	0.943	Contact Map
4ab7A	3	0.3292	1.7	0.943	Contact Map
1nhkR	3	0.3789	1.7	0.943	Contact Map
1wkjA	4	0.3416	1.6	0.943	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0062 seconds.