CNP1 - PFAM28P - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

CNP1 - CNP1-like family

PFAM:	PF08750	Sequences: DEDKPWKEGEVPLPPYPKDENLIPFYVSAATSFRFFIDPASLSVGKDGVVRYTLVARSPSGARNVSYEGIRCATREYKLYAYGRPDNGTWSPARNSEWRPIEDRGANRYHAALARDYFCPGGAPIRSAAEIVRALR	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_10
Length:	136 (132)
Sequences:	2028 (1533)
Seq/√Len:	133.4
META:	0.891

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
125_I	131_I	4.542	1.00
22_L	55_V	4.076	1.00
57_R	63_R	3.761	1.00
78_K	96_S	3.618	1.00
24_P	34_R	3.084	1.00
21_N	40_A	3.015	1.00
86_D	89_T	2.535	1.00
21_N	39_P	2.484	1.00
33_F	56_A	2.470	1.00
23_I	39_P	2.177	1.00
71_R	74_T	2.176	1.00
45_G	49_V	2.157	1.00
16_Y	83_G	2.075	1.00
36_F	57_R	2.049	1.00
41_S	53_T	2.048	1.00
18_K	21_N	1.886	1.00
79_L	82_Y	1.866	1.00
69_G	80_Y	1.856	1.00
77_Y	99_R	1.843	1.00
54_L	109_Y	1.828	1.00
112_A	116_D	1.795	1.00
77_Y	110_H	1.741	1.00
42_L	132_V	1.727	1.00
54_L	66_S	1.724	1.00
33_F	58_S	1.715	1.00
131_I	134_A	1.589	1.00
71_R	76_E	1.577	1.00
19_D	63_R	1.546	1.00
44_V	128_A	1.524	1.00
35_F	56_A	1.517	1.00
55_V	65_V	1.483	1.00
84_R	89_T	1.450	1.00
113_L	118_F	1.423	1.00
126_R	130_E	1.336	1.00
84_R	91_S	1.319	1.00
66_S	79_L	1.289	1.00
120_P	134_A	1.279	1.00
26_Y	29_A	1.240	1.00
52_Y	70_I	1.219	1.00
125_I	130_E	1.216	1.00
16_Y	88_G	1.212	1.00
76_E	97_E	1.212	1.00
129_A	133_R	1.207	1.00
27_V	35_F	1.194	0.99
9_G	46_K	1.170	0.99
70_I	101_I	1.169	0.99
17_P	41_S	1.157	0.99
128_A	132_V	1.156	0.99
49_V	69_G	1.134	0.99
130_E	133_R	1.122	0.99
44_V	50_V	1.103	0.99
11_V	67_Y	1.102	0.99
127_S	130_E	1.083	0.99
10_E	92_P	1.072	0.99
53_T	67_Y	1.062	0.99
25_F	35_F	1.062	0.99
120_P	125_I	1.049	0.99
56_A	109_Y	1.035	0.99
6_W	49_V	1.034	0.99
93_A	96_S	1.008	0.98
47_D	69_G	0.993	0.98
25_F	28_S	0.990	0.98
9_G	12_P	0.988	0.98
76_E	100_P	0.972	0.98
22_L	38_D	0.958	0.98
125_I	134_A	0.954	0.97
108_R	111_A	0.948	0.97
24_P	36_F	0.915	0.97
128_A	131_I	0.908	0.97
51_R	67_Y	0.904	0.97
13_L	53_T	0.902	0.96
91_S	94_R	0.893	0.96
54_L	110_H	0.890	0.96
129_A	132_V	0.879	0.96
53_T	90_W	0.877	0.96
68_E	79_L	0.868	0.96
31_T	35_F	0.857	0.95
18_K	40_A	0.856	0.95
82_Y	91_S	0.846	0.95
99_R	102_E	0.841	0.95
103_D	111_A	0.839	0.95
47_D	78_K	0.834	0.95
42_L	128_A	0.828	0.94
52_Y	118_F	0.823	0.94
78_K	104_R	0.816	0.94
70_I	131_I	0.816	0.94
28_S	112_A	0.805	0.93
127_S	133_R	0.802	0.93
17_P	38_D	0.798	0.93
78_K	105_G	0.794	0.93
66_S	82_Y	0.792	0.93
7_K	10_E	0.785	0.93
70_I	118_F	0.783	0.92
16_Y	65_V	0.782	0.92
40_A	53_T	0.778	0.92
107_N	111_A	0.777	0.92
53_T	65_V	0.776	0.92
17_P	22_L	0.775	0.92
78_K	97_E	0.774	0.92
52_Y	68_E	0.761	0.91
33_F	59_P	0.751	0.91
124_P	127_S	0.747	0.91
38_D	53_T	0.735	0.90
12_P	15_P	0.729	0.90
35_F	111_A	0.728	0.89
101_I	110_H	0.722	0.89
82_Y	93_A	0.721	0.89
16_Y	89_T	0.721	0.89
120_P	131_I	0.719	0.89
45_G	69_G	0.716	0.89
58_S	62_A	0.715	0.89
17_P	83_G	0.714	0.89
33_F	36_F	0.712	0.88
36_F	75_R	0.712	0.88
23_I	135_L	0.711	0.88
31_T	108_R	0.708	0.88
35_F	107_N	0.705	0.88
25_F	113_L	0.703	0.88
120_P	130_E	0.696	0.87
42_L	131_I	0.694	0.87
49_V	80_Y	0.689	0.87
37_I	42_L	0.688	0.87
45_G	51_R	0.688	0.87
50_V	118_F	0.672	0.85
64_N	93_A	0.670	0.85
77_Y	109_Y	0.669	0.85
28_S	90_W	0.669	0.85
24_P	28_S	0.665	0.85
117_Y	134_A	0.662	0.85
75_R	115_R	0.661	0.84
126_R	131_I	0.661	0.84
52_Y	61_G	0.654	0.84
107_N	110_H	0.654	0.84
83_G	88_G	0.649	0.83
54_L	113_L	0.649	0.83
58_S	63_R	0.645	0.83
11_V	78_K	0.638	0.82
37_I	110_H	0.637	0.82
100_P	103_D	0.632	0.82
6_W	12_P	0.631	0.82
105_G	108_R	0.629	0.81
85_P	89_T	0.629	0.81
116_D	121_G	0.627	0.81
21_N	41_S	0.627	0.81
7_K	14_P	0.626	0.81
130_E	134_A	0.625	0.81
123_A	129_A	0.620	0.81
92_P	96_S	0.619	0.80
95_N	99_R	0.618	0.80
13_L	81_A	0.617	0.80
123_A	132_V	0.613	0.80
98_W	119_C	0.611	0.80
8_E	47_D	0.608	0.79
25_F	54_L	0.606	0.79
77_Y	84_R	0.606	0.79
9_G	45_G	0.601	0.78
35_F	90_W	0.594	0.78
93_A	110_H	0.594	0.78
25_F	36_F	0.591	0.77
47_D	80_Y	0.591	0.77
37_I	50_V	0.586	0.77
4_K	7_K	0.584	0.76
84_R	88_G	0.579	0.76
33_F	37_I	0.579	0.76
127_S	135_L	0.575	0.75
45_G	73_A	0.573	0.75
58_S	61_G	0.571	0.75
25_F	31_T	0.567	0.74
5_P	46_K	0.566	0.74
31_T	69_G	0.562	0.74
26_Y	112_A	0.548	0.72
83_G	89_T	0.548	0.72
13_L	92_P	0.547	0.72
24_P	57_R	0.544	0.71
45_G	80_Y	0.543	0.71
60_S	77_Y	0.543	0.71
24_P	27_V	0.542	0.71
21_N	123_A	0.541	0.71
127_S	132_V	0.538	0.70
117_Y	135_L	0.536	0.70
5_P	12_P	0.533	0.70
26_Y	31_T	0.532	0.70
52_Y	110_H	0.530	0.69
127_S	131_I	0.526	0.69
4_K	9_G	0.525	0.69
66_S	109_Y	0.524	0.68
77_Y	104_R	0.523	0.68
101_I	114_A	0.522	0.68
8_E	69_G	0.515	0.67
33_F	60_S	0.513	0.67
27_V	30_A	0.508	0.66
57_R	70_I	0.504	0.66
12_P	26_Y	0.504	0.66
43_S	128_A	0.503	0.65
27_V	76_E	0.502	0.65
58_S	65_V	0.501	0.65
52_Y	77_Y	0.500	0.65
41_S	114_A	0.500	0.65

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3zh5A	1	0.8235	8.7	0.945	Contact Map
4rz7A	2	0.4412	5.6	0.95	Contact Map
3c2eA	5	0.8529	3.6	0.954	Contact Map
1q87A	1	0.4265	3.5	0.955	Contact Map
4arfA	2	0.4338	3.3	0.955	Contact Map
3j20F	1	0.3897	3.1	0.956	Contact Map
4l67B	1	0.1471	3	0.956	Contact Map
3pajA	2	0.8971	2.9	0.956	Contact Map
3fsdA	2	0.3603	2.8	0.957	Contact Map
4pfuA	2	0.6618	2.7	0.957	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0066 seconds.